KEGG   Halomicronema hongdechloris: XM38_045530Help
Entry
XM38_045530       CDS       T04928                                 

Gene name
sodB_2
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hhg  Halomicronema hongdechloris
Brite
Enzymes [BR:hhg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XM38_045530 (sodB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASC73584
UniProt: A0A1Z3HTG3
LinkDB All DBs
Position
4794665..4795264
Genome map
AA seq 199 aa AA seqDB search
MAYQLPALPYDYSALEPYISKTTLEFHHDKHHAAYVTKFNNAVAATELASQPIEQVIKTV
AKDPTKTGIFNNAAQAWNHTFYWNSMTPGGSQPSGKLAEKIETDFGSFDQCVEAFKTAAA
TQFGSGWAWLVLEDGQLKVTKTANADNPLTHNQVPLLTMDVWEHAYYLDYQNRRPDYIQT
FLQHLVNWDFAAENLAAAQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttaccaactaccggccctgccctacgactacagtgccttagaaccctacatttct
aagaccaccctagagttccatcacgacaaacatcacgccgcctatgtgaccaagttcaac
aatgcggtagcggcaacagaattagccagccagcccattgagcaggtgattaaaactgtg
gccaaagatcccaccaagacagggattttcaataatgccgcccaagcctggaatcatacc
ttttactggaacagcatgacccccggtggcagtcagcccagtggcaaattagccgagaaa
attgagactgatttcggcagttttgaccagtgtgtcgaggcctttaaaacagccgccgcc
acccaatttggcagcggctgggcctggctggtgctagaggatggccagctcaaggtaacc
aaaacggccaatgccgacaatccccttacccataatcaagtgcccctgttaaccatggat
gtgtgggaacacgcctattatttggattatcaaaacagacggcccgactacatccagacc
tttctacagcatctggtcaattgggactttgctgctgaaaatctggcagcggcccaataa

DBGET integrated database retrieval system