KEGG   Halomicronema hongdechloris: XM38_051850Help
Entry
XM38_051850       CDS       T04928                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00473  D-Alanine metabolism
hhg00550  Peptidoglycan biosynthesis
hhg01100  Metabolic pathways
hhg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hhg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    XM38_051850 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XM38_051850 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    XM38_051850 (ddl)
Enzymes [BR:hhg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     XM38_051850 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hhg01011]
 Precursor biosynthesis
  Amino acid ligase
   XM38_051850 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ASC74210
UniProt: A0A1Z3HV66
LinkDB All DBs
Position
5448534..5449613
Genome map
AA seq 359 aa AA seqDB search
MVKQRIGLLFGGCSGEHEVSIASARAIAEALAKDGNDNAYEVRLVYIAKDGSWHGPETAE
QVLQTAEPLVTRGNGGATLARLPVLEQVNQIDVWFPILHGPNGEDGTVQGVLTLMQQPFV
GSGVLGSALGMDKIAMKMAFAQAGLPQVDYMAVNRSQVWSNACVLPKLCDRIEAQLGYPC
FVKPANLGSSVGISKVRSRDQLETALDNAASYDRRLIVEAAVTAREVECAVLGNDMPQAS
VVGEISFDSDFYDYDTKYTAGQAALQIPAPLPETISRQIQAYAVQAVQAVDAAGLARVDF
FYVETTGQVLINEINTLPGFTATSMYPRLWQASGLSFPALVDRLIQLALARARETPRSR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcagcgcatcggccttctattcggtggctgttctggtgaacatgaggtctca
attgcctcggcccgggccattgctgaggcattagccaaggatggtaatgacaatgcctac
gaggtccggctggtctatattgccaaggatggcagttggcatggtcctgagacggctgaa
caggtactgcagaccgctgaaccactggtgactcgtggcaacggaggggcgactctggcg
cgtttgccagtattggagcaggtgaaccagattgatgtttggttccccattctccatggt
cccaacggagaagacggtaccgtgcagggagtgttgacgctgatgcagcagccttttgtc
ggctcaggggtgctgggatcggctctaggcatggataaaatcgccatgaagatggccttt
gcccaggcagggttgccccaggtggattatatggccgttaatcgttctcaggtctggtcc
aatgcctgtgtgttgccaaagctatgcgatcgcatcgaagcccaactcggctatccctgc
ttcgtcaaaccggccaacctgggctcctcggtcgggatctcgaaggtgcggtctcgagat
cagctggaaacagccctagataatgctgccagttatgatcggcgactgattgtagaagcg
gcggtaaccgcccgggaagtagagtgtgctgttctcggtaatgatatgcctcaggcctcc
gtggtcggggagatcagctttgacagcgacttctacgactacgataccaaatacactgcc
ggccaagcggccttacagatcccggctcccttgccagagaccatcagccgccagattcaa
gcgtatgccgttcaggctgtgcaggcggtcgacgcggccggcttagctcgcgtcgatttc
ttctatgtggaaaccactggccaggtgctgatcaacgagatcaatactctgccggggttt
accgccacgagcatgtatccccgactgtggcaggctagcggcctgtcctttccagccctg
gtggatcgcctgatccagctggccttagcgcgggcccgggaaacgcctcgttctcgttag

DBGET integrated database retrieval system