KEGG   Halomonas hydrothermalis: CLM76_01925Help
Entry
CLM76_01925       CDS       T05117                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00010  Glycolysis / Gluconeogenesis
hhh00071  Fatty acid degradation
hhh00350  Tyrosine metabolism
hhh00625  Chloroalkane and chloroalkene degradation
hhh00626  Naphthalene degradation
hhh01100  Metabolic pathways
hhh01110  Biosynthesis of secondary metabolites
hhh01120  Microbial metabolism in diverse environments
hhh01130  Biosynthesis of antibiotics
hhh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM76_01925
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLM76_01925
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CLM76_01925
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLM76_01925
   00626 Naphthalene degradation
    CLM76_01925
Enzymes [BR:hhh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CLM76_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ATH76444
UniProt: A0A291JQH4
LinkDB All DBs
Position
complement(428351..429379)
Genome map
AA seq 342 aa AA seqDB search
MDSTMRAAVVREFGQPLVIEEVDVPRPKQGEVLMKVAASGVCHTDLHAAHGDWPVKPSPP
FIPGHEGVGYIVAVGEGVSHVKEGDRIGVPWLYSACGYCEHCLGGWETLCESQQNTGYSV
NGGFADYTLADAGYVGRLPASVDFIDIAPVLCAGVTVYKGLKMTDTRPGQWVVISGIGGL
GHMAVQYAKAMGLNVAAVDIDDGKLALAERLGATVTVNAMKTDPAAYLKKAIGGAHGALV
TAVSPKAFDQAQNMLRRGGTLVLNGLPPGDFPLPIFSTVLNGITIRGSIVGTRSDLQEAL
DFAAEGKVTATVATDTLDNINDVFQRMIDGKIEGRIVLDMAS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggatagcacaatgcgcgcagcagtggttcgcgagtttggccagccgctggtcatcgaa
gaagtcgatgtacctcgtcccaaacagggcgaagtattgatgaaagtggcggcctccggg
gtttgccataccgatttacacgccgcccacggtgattggccggtgaagccttcgccaccg
tttattcccgggcatgagggcgtcggctacatcgtggccgtgggagagggcgtctcccat
gtcaaagagggagaccgcatcggtgtgccctggctttattccgcctgtggctactgcgag
cactgtctgggcgggtgggagacgctgtgcgagtctcagcaaaacacaggctatagcgtc
aacggcggctttgccgactataccttggcagatgcaggctatgtggggcggctgccggcg
tcggtggatttcatcgacatcgcgccggtgctgtgcgctggggtgacggtctataaaggc
ttgaaaatgaccgacactcgcccgggccagtgggtggtgatctccgggattggcgggctg
gggcacatggccgtgcagtatgccaaggccatggggctgaacgtcgcagcggtggatatc
gatgacggcaagctggccttggccgaacgtctgggggcgacggtgacggtcaacgccatg
aaaaccgacccggcggcctatctgaagaaagccattggcggagcccatggggcattggtc
acggccgtttcaccgaaagccttcgatcaggcgcaaaacatgctgcgtcgcggtggcacg
ctggtgctgaatgggctgccgcccggtgatttcccgctgccgatcttcagcacggtactc
aacggcattaccattcgcggctctatcgtcggtacacgcagcgacctgcaggaagcgctg
gacttcgccgccgaaggcaaggtcacggccacggtggccaccgacacgctggacaacatc
aacgacgttttccagcgcatgatcgacggcaagatcgaaggccgtatcgtattggacatg
gcgagctaa

DBGET integrated database retrieval system