KEGG   Halomonas hydrothermalis: CLM76_07925Help
Entry
CLM76_07925       CDS       T05117                                 

Gene name
ntrB
Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00910  Nitrogen metabolism
hhh02010  ABC transporters
Module
hhh_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CLM76_07925 (ntrB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CLM76_07925 (ntrB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hhh02000]
    CLM76_07925 (ntrB)
Transporters [BR:hhh02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    CLM76_07925 (ntrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ATH77516
UniProt: A0A291JTL5
LinkDB All DBs
Position
complement(1675059..1675871)
Genome map
AA seq 270 aa AA seqDB search
MPGVHPVLLRLRDTLVKNVLPPVVVLAILIGLWEALCSHPGAALPPPSQVLNDTWELIIH
PFYDYGGNDKGMGWQILASLERVAYGFLLAVVVGISLGVLVGQSTWALRGLDPVFQVLRT
VPPLAWLPISLAGFQDSTPSAIFVIFITAIWPIIINTSVGVRNIPEDYRNVARVIRLNGM
EYFTRIMLPAAAPYIFSGLRIGVGLSWLAIVAAEMLIGGVGIGFFIWDAWNASMLSDIVL
ALIYVGIVGFILDRIVAFIGQCVTRGTTQS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcgtgcaccctgtgctgctacgcctgcgcgataccctggtcaagaacgtgctg
ccgccggtggtcgtgctggccattctgatcggcctgtgggaagcgctgtgctcccatcct
ggcgcggcgctgccgccgccctcgcaggtgctcaacgatacctgggagctgatcattcat
cccttctacgactacggcggcaacgacaagggcatgggctggcagattctggccagcctg
gaacgcgtggcctatggcttcctgctggcggtggtggtaggcatcagcctgggcgtgctg
gtgggccaatcgacctgggccctgcgtggcctcgaccccgtgtttcaggtgctgcgcacc
gtgcctccgctggcctggctgccgatttcactggccgggtttcaggacagcactccttcg
gccattttcgtgattttcatcaccgccatctggcccatcatcatcaacacctcggtgggg
gtgcgtaatatccccgaggattaccgcaacgtggcccgcgtgattcgcctcaacggcatg
gagtatttcacccgtatcatgctgcccgccgccgcaccctatatcttctcgggcctgcgc
attggagtagggctttcctggctggccatcgtggccgccgagatgctgattggcggcgtg
ggcatcggctttttcatctgggacgcctggaatgcctccatgctcagcgacatcgtgctg
gcactcatctacgtgggcatcgtgggcttcattcttgaccgcatcgtggccttcattggc
cagtgcgtgacccgtggcaccacccaaagctaa

DBGET integrated database retrieval system