KEGG   Halomonas hydrothermalis: CLM76_11615Help
Entry
CLM76_11615       CDS       T05117                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00020  Citrate cycle (TCA cycle)
hhh00190  Oxidative phosphorylation
hhh00650  Butanoate metabolism
hhh01100  Metabolic pathways
hhh01110  Biosynthesis of secondary metabolites
hhh01120  Microbial metabolism in diverse environments
hhh01130  Biosynthesis of antibiotics
hhh01200  Carbon metabolism
Module
hhh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hhh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hhh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLM76_11615
   00650 Butanoate metabolism
    CLM76_11615
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLM76_11615
Enzymes [BR:hhh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CLM76_11615
    1.3.5.4  fumarate reductase (quinol)
     CLM76_11615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 FAD_binding_3 GIDA HI0933_like NAD_binding_8 FAD_oxidored Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ATH78201
UniProt: A0A291JVG0
LinkDB All DBs
Position
2467063..2468835
Genome map
AA seq 590 aa AA seqDB search
MSNLRSLTFDAIIVGGGGSGLRAALELAKSGKKTAVLSKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGGDYIADQDAAEYMCSEGPKAVFELEHMGLPFSRFDNGRIYQRP
FGGQSKNFGEGGQAARTCAAADRTGHALLHTLYQNNLKNNTTFLNEWYAVDLVKNANGDV
VGCIAMCIETGEVVHVKSKATVLATGGAGRIYASTTNALINTGDGIGMALRAGFPMQDME
MWQFHPTGIYGAGTLVTEGCRGEGGYLVNKDGERFMERYAPNAKDLAGRDVVARSMVMEI
LEGRGCGEKGDHVFLKLDHLGEEVLGKRLPGIVELSKTFAHVDPAKDPIPVVPTCHYMMG
GIPTNIHGQAITQDESGNDKIVNGLFACGEAACVSVHGANRLGGNSLLDLVVFGRAAGMF
IEGALNEGIEYLDASESDIETAMKRITRWNESEGGESIPELKAELQSIMQNSFGVFREEK
NMQEGVKQLAELRGRIDNAHLPDKSNAFNTARVEALELDNLMEVAEATAIAALERKESRG
AHSRYDYPDRDDVNWLKHSLYFPASKELKKRDVNFKPKTVDTFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaccttcgtagcctgacgtttgacgccatcattgtgggtggcggtggctctggc
ctgcgtgccgctcttgaactggccaagtccggtaaaaagacagcggtactgtccaaagtg
ttcccgacacgctcccacacggtttctgctcagggcggtatcacctgtgcgattgcctcc
gccgacccgaacgacgactggcgctggcacatgtatgacaccgtcaagggcggcgactat
atagctgaccaggacgctgccgagtacatgtgttcagaaggccccaaggccgtcttcgaa
ctcgagcacatgggcctgccgttctcgcgtttcgataatggccgcatctatcagcgtccg
ttcggtggtcagtccaagaactttggtgaaggtggtcaggccgcacgtacctgcgccgcc
gccgaccgtaccggtcacgcgctgctgcacaccctgtaccagaacaacctgaagaacaac
accacgttcctgaacgagtggtacgcggtggatctggtcaagaacgccaacggtgacgtg
gtgggctgtattgccatgtgcatcgaaaccggcgaagtggtgcacgtcaagtcgaaagcc
accgtgctggcgaccggcggtgccggacgcatctacgcgtcgaccaccaacgccctgatc
aacacgggtgacggcatcggcatggcgctgcgcgctggtttcccgatgcaggacatggaa
atgtggcagttccacccgaccggtatctacggtgcgggcacgctggtcaccgaaggttgc
cgtggtgaaggtggttacctggtcaacaaggatggcgagcgtttcatggagcgctatgcg
cccaacgccaaagacctggcgggccgtgacgttgtggcgcgttccatggtcatggaaatc
ctcgaaggccgcggctgtggcgagaagggcgaccacgtgttcctgaagctggatcacctg
ggcgaagaagtacttggcaagcgtctgcccggcatcgtcgagctctccaagacctttgct
cacgtcgacccggccaaggacccgattccggtcgtaccgacctgccactacatgatgggc
ggtatcccgaccaacattcatggtcaggcgatcacccaggacgagagcggcaacgacaag
atcgtcaacggtctgttcgcgtgtggcgaagctgcctgtgtatcggtacacggtgccaac
cgtctgggcggcaactcgctgctggatctggtggtcttcggtcgcgctgcgggcatgttc
atcgaaggcgcgctgaacgaaggtatcgaatatctggatgcctccgagtcggacatcgaa
accgccatgaagcgcatcactcgctggaacgaatctgaaggcggtgaaagcattcctgag
ctcaaggccgagctgcaaagcatcatgcagaactctttcggtgtattccgtgaagagaaa
aacatgcaggaaggtgtcaaacagctggcggaactgcgtggccgcatcgacaatgcgcac
ctgccggacaagtccaacgccttcaacactgcccgtgtcgaagcgctggagctggacaac
ctgatggaagtggcagaagcaacggcgattgctgcccttgagcgtaaagagagccgtggt
gcccactcgcgctacgactaccccgaccgtgatgatgtcaactggctgaaacactcgctc
tacttcccggctagcaaagagctgaagaagcgcgacgtcaacttcaagccgaaaacagtc
gatacgttcgagccgaaggttcgcacctactaa

DBGET integrated database retrieval system