KEGG   Halomonas hydrothermalis: CLM76_11620Help
Entry
CLM76_11620       CDS       T05117                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00020  Citrate cycle (TCA cycle)
hhh00190  Oxidative phosphorylation
hhh00650  Butanoate metabolism
hhh01100  Metabolic pathways
hhh01110  Biosynthesis of secondary metabolites
hhh01120  Microbial metabolism in diverse environments
hhh01130  Biosynthesis of antibiotics
hhh01200  Carbon metabolism
Module
hhh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hhh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hhh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLM76_11620 (sdhB)
   00650 Butanoate metabolism
    CLM76_11620 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLM76_11620 (sdhB)
Enzymes [BR:hhh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CLM76_11620 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CLM76_11620 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: ATH78202
UniProt: A0A291JVC3
LinkDB All DBs
Position
2468863..2469573
Genome map
AA seq 236 aa AA seqDB search
MSNLQVSVYRYNPETDSAPYMQEFQVDTKGRDLMVLDVLHLMKEQDSGLAYRRSCREGVC
GSDGMNMNGKNGLACITPLSDVVKNNKLTLRPLPGLPVIRDMVVDMGLFYKQYERIQPYL
QNDTPAPAIERLQSPEERDKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQSYRFL
ADSRDTATRERLTSLEDPFSVFRCRGIMNCVAVCPKGLNPTRAIGKIREMLLADAT
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatcttcaggtatccgtgtatcgctacaacccggaaaccgactccgcgccctac
atgcaggagttccaggtcgataccaaaggtcgcgatctgatggtgctggatgtactgcac
ctgatgaaagagcaggacagtggcctggcctatcgccgcagctgccgtgaaggcgtgtgc
ggctccgatggcatgaacatgaacggcaagaacggcctggcgtgcatcacgccgctgtcg
gacgtcgtgaaaaacaacaagctgactctgcgtccgttgcctggcctgccggtcatccgt
gacatggtcgtggacatgggcttgttctacaagcagtacgagcgcatccagccgtatctg
caaaacgacacgccagcgcccgccatcgagcgtctgcagtcgccagaagagcgcgacaag
ctggacggcctgtacgagtgtatcctgtgtgcctgctgctccacgtcctgcccgtcgttc
tggtggaacccggacaagttcgtgggcccggcgggtctgctgcagtcataccgcttcctg
gccgacagtcgcgataccgccacccgtgagcgtctgaccagcctggaagacccgttctcg
gtattccgttgccgcggcatcatgaactgcgtggcggtatgcccgaaaggtctgaatccg
actcgtgcaattggtaaaattcgtgaaatgttgctcgctgatgcgacgtaa

DBGET integrated database retrieval system