KEGG   Halomonas hydrothermalis: CLM76_17925Help
Entry
CLM76_17925       CDS       T05117                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00020  Citrate cycle (TCA cycle)
hhh00270  Cysteine and methionine metabolism
hhh00620  Pyruvate metabolism
hhh00630  Glyoxylate and dicarboxylate metabolism
hhh00680  Methane metabolism
hhh01100  Metabolic pathways
hhh01110  Biosynthesis of secondary metabolites
hhh01120  Microbial metabolism in diverse environments
hhh01130  Biosynthesis of antibiotics
hhh01200  Carbon metabolism
Module
hhh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hhh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hhh_M00012  Glyoxylate cycle
hhh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLM76_17925
   00620 Pyruvate metabolism
    CLM76_17925
   00630 Glyoxylate and dicarboxylate metabolism
    CLM76_17925
  09102 Energy metabolism
   00680 Methane metabolism
    CLM76_17925
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CLM76_17925
Enzymes [BR:hhh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     CLM76_17925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ATH79360
UniProt: A0A291JYN3
LinkDB All DBs
Position
complement(3858925..3859899)
Genome map
AA seq 324 aa AA seqDB search
MKDPVRIAITGGAGQISYSLIFRIAAGDMLGPDQPVILQLLEIPQAMGALNGVVMEVNDC
AFPLVQDIVATDDPNVAFKDADFALLVGARPRGPGMERKDLLEANAAIFSVQGKALNDHA
SRDVKVLVVGNPANTNALIASCNAPDLDAGQFTAMTRLDHNRALTQLAQKTGKHVTDVEN
MIIWGNHSATQYPDLAQCKVDGKAAFDLVERDWYENDFIPTVQQRGAAIIKARGASSAAS
AASSAIDHMRDWALGCDGIVSMAIPSDGSYGIAEGIIYSYPVRCQGGKYEIVQGFELDAF
SKEKMQATEKELREERAAVEHLLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatccagtacgtattgcgattaccggcggtgccggccagatcagctactctctt
attttccgcattgccgctggcgacatgctggggccggatcagcccgtcattctccagctt
ctcgaaattccccaagccatgggcgcgctgaacggcgtggtcatggaagtgaacgactgt
gcgttcccgctggtgcaagatatcgtcgccaccgacgatcccaacgtggcgttcaaggat
gccgacttcgctctgctggtaggtgctcgtccgcgtggccccggcatggagcgtaaagac
ctgctggaagccaacgccgccatcttctccgtacaaggtaaagcgctgaacgaccacgcc
agccgcgacgtgaaagtgctggtcgtcggcaacccggccaacaccaacgcgctgatcgcc
tcctgcaacgcgccggacctggacgctggccagttcaccgccatgacccgtctggaccac
aaccgcgccctgacgcagctggcacagaagaccggcaagcacgtcaccgacgtcgaaaac
atgatcatctggggcaaccacagtgccacccagtacccggacctggcccagtgcaaggta
gacggcaaagccgctttcgatctggtcgagcgcgactggtacgaaaacgacttcatcccg
accgtacagcagcgcggtgccgccatcatcaaggcgcgcggcgcctcgtctgccgcctct
gctgcgtcttccgccatcgaccacatgcgtgattgggcgctgggctgcgacggtatcgtc
agcatggccatcccctccgacggcagctacggcatcgccgaaggcatcatctactcctac
ccggtgcgctgccagggtggcaagtacgaaatcgtacaaggtttcgaactcgatgcgttc
agcaaagagaagatgcaggccacggaaaaagaactgcgtgaagagcgcgctgccgtcgag
cacctgctcggctaa

DBGET integrated database retrieval system