KEGG   Halomonas hydrothermalis: CLM76_18000Help
Entry
CLM76_18000       CDS       T05117                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00290  Valine, leucine and isoleucine biosynthesis
hhh00770  Pantothenate and CoA biosynthesis
hhh01100  Metabolic pathways
hhh01110  Biosynthesis of secondary metabolites
hhh01130  Biosynthesis of antibiotics
hhh01210  2-Oxocarboxylic acid metabolism
hhh01230  Biosynthesis of amino acids
Module
hhh_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
hhh_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CLM76_18000
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CLM76_18000
Enzymes [BR:hhh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     CLM76_18000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: ATH79375
UniProt: A0A291JYU5
LinkDB All DBs
Position
complement(3880304..3882148)
Genome map
AA seq 614 aa AA seqDB search
MPQYRSRTTTAGRNMAGARALWRATGMKDDDFHKPIIAVANSFTQFVPGHVHLKDMGQLV
AREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDIIADSVEYMCNAHCADALVCIS
NCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKTKLLDHGLDLVDAMVMAADDSVDDETLA
EVERSACPTCGSCSGMFTANSMNCLMEALGLALPGNGTVLATHADRRRLFETAGHRIVEL
AKRYYEGEEAHLLPRAIGNKAAFKNAMTLDIAMGGSTNTILHLLAAAQEAEVDFTMADID
RLSREVPQLCKVAPNTQKYHIEDVHRAGGIMAILGELDRAGVLDTSVPTVYGDSLKDALD
EWDIMRSPSSEVVEFFKAGPGGIPTQTAFSQSARWPSLDGDRATGCIRDLEHAFSREGGL
AVLYGNIALDGCVVKTAGVDDSILVFEGKAHVVESQDQAVANVLDGKVKEGDVVVIRYEG
PKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHVSPEAAAGGAIGLVE
QGDTILIDIPNRTINVQLSDAELAKRREAMESRGKDAWKPVEQRPRKVTPALKAYALLAT
SADKGAVRDLSKLD
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtatcgctcccgtaccactaccgctggccgcaacatggcaggcgctcgtgcc
ctttggcgtgccaccggcatgaaggatgacgactttcacaaaccgatcatcgcggtagcc
aactcgttcacccagttcgtgcccggccatgtgcacctgaaagacatggggcaactggtc
gcccgcgaaatcgaaaaagcgggtggcgttgccaaagagttcaataccatcgccgtggat
gacggtatcgccatgggccatgacggcatgctctactcgctgcccagccgtgatatcatt
gccgacagcgtcgagtacatgtgcaacgcccactgtgccgatgcgctggtgtgcatttcc
aactgcgacaagatcacccccggaatgctgatggccgccatgcggctcaacattcccgtc
attttcgtctccggcggccccatggaagccggcaagaccaagcttctggatcacggcctg
gatctggtcgatgccatggtcatggccgcagacgacagcgtcgacgacgaaaccctggca
gaagtcgagcgcagcgcatgccccacctgtggcagctgctcgggcatgttcaccgccaac
tccatgaactgcctgatggaggcgctgggcctggcacttcccggtaacggcaccgtgctg
gcgacccatgccgatcgccgtcgcctgttcgaaacggcgggccatcgtatcgtcgagctg
gccaagcgctattacgaaggcgaagaggcacacctgctgccccgcgccattggcaacaag
gccgccttcaagaatgccatgaccctggacatcgccatgggcggttccaccaataccatc
ctgcacctgctggcggcggctcaagaggcagaagtcgacttcaccatggcggatatcgac
cgcctttcccgtgaagtgccgcagctgtgtaaagtggcgcccaatactcagaaataccat
atcgaagacgtgcaccgcgcgggtggcatcatggccattctgggcgagctggaccgggcg
ggggtgctggatacctcggtgcccaccgtgtacggcgacagcctgaaggacgcgctggac
gagtgggatatcatgcgctcgcccagttcagaagtggtcgaattcttcaaggcaggcccg
gggggcattccgacccaaaccgcgttctcccagagcgcccgttggccaagcctggacggc
gaccgtgccaccggctgtatccgcgacctggagcacgccttctcccgtgagggcggcctc
gccgtgctctacggcaacatcgccctggatggctgtgtggtcaagaccgccggtgtagac
gactccatcctggtattcgagggcaaggctcacgtggtggagtcccaggatcaggcagtg
gccaacgtgctggatggcaaagtcaaagagggcgatgtggtggtcatccgctacgaaggc
cccaaaggtggccccggtatgcaagagatgctgtaccccacctcctacctgaaatccaaa
gggctgggcaaagcgtgcgcgctgctgaccgacggccgtttctccgggggcacctcgggc
ctgtcgattggtcacgtatcgcctgaggccgccgccgggggcgccatcgggctggtcgag
cagggcgataccattctgatcgacatccccaaccgcaccatcaacgtgcagctgagcgat
gccgagctggccaagcgccgcgaggccatggagtcgcgtggcaaggacgcctggaagccc
gtcgagcagcgcccgcgcaaggtgacgcctgccctcaaggcctatgccctgctggccacc
tccgccgacaagggcgcagtacgcgacctctccaaactggattga

DBGET integrated database retrieval system