KEGG   Haloarcula hispanica ATCC 33960: HAH_1276Help
Entry
HAH_1276          CDS       T01597                                 

Definition
(GenBank) mandelate racemase/muconate lactonizing family protein
  KO
K05308  gluconate/galactonate dehydratase [EC:4.2.1.140]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00030  Pentose phosphate pathway
hhi00052  Galactose metabolism
hhi01100  Metabolic pathways
hhi01120  Microbial metabolism in diverse environments
hhi01200  Carbon metabolism
Module
hhi_M00308  Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:hhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HAH_1276
   00052 Galactose metabolism
    HAH_1276
Enzymes [BR:hhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.140  gluconate/galactonate dehydratase
     HAH_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AEM56891
UniProt: G0HPX2
LinkDB All DBs
Position
I:complement(1226072..1227322)
Genome map
AA seq 416 aa AA seqDB search
MGKANDVDYADLHDPNAEYTMRELSAETMGVTAKRGGGRDVEITDVQTTMVDGNFPWTLV
RIYTDAGIVGTGEAYWGAGVPELIERMKPFVVGENPLDIDRLYEHLIQKMSGEGSVEGVT
VTAIAGIEVALHDLAGKILEVPAYQLLGGKYRDEMRVYCDCHTEEEADADACAEEARRVV
DELGYDALKFDLDVPSGLEKDRANRHLRPGEIRHKAEIVEKVTEEVKDEADVAFDCHWTF
SGSSGKRLADAIEEYDVWWLEDPVPPENLEVQEEVTKSTTTPITVGENRYRVTEERRLIE
NQAVDMIAPDMPKVGGMRETRKVADVANQYYIPVAMHNVSSPIATMASAHVGASVPNSLA
VEYHSYELGWWEDLVEETVIEDGYIEIPEEPGLGLTLDLDAVEEHVVEGDTVFDEA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggcaaacgacgtagactacgctgacctgcacgacccgaacgcagagtacacc
atgcgggagctctctgcggagacaatgggcgtcaccgccaagcgcggtggcggccgtgac
gtggagatcacagacgttcagacgacgatggtcgacgggaacttcccgtggacgctcgtc
cggatctacaccgacgcaggcatcgtcggtacgggcgaggcatactggggcgcgggcgtc
ccggaactcatcgagcggatgaagccgttcgtcgtcggcgagaacccgctggatatcgac
cgcctctacgagcacctcatccagaagatgagcggcgaggggagcgtcgagggcgtcacc
gtgacggccatcgctggcatcgaggtcgcactgcacgacctcgcgggcaagatcctcgaa
gtgccggcctaccagctcctgggcggcaagtaccgcgacgagatgcgcgtgtactgcgac
tgccataccgaggaagaggctgacgccgacgcctgcgccgaggaggcgcgccgcgtcgtc
gacgaactgggctacgacgcgttgaagttcgatctcgacgtgccgagcggcctcgaaaag
gaccgcgcgaaccgccacctccgcccgggcgaaatccgccacaaggccgagatcgtcgag
aaggtcaccgaggaggtcaaagacgaggccgacgtggccttcgactgtcactggacgttc
tcgggcagctccgggaagcgcctcgccgacgccatcgaggagtacgacgtctggtggctc
gaagaccccgttccgccggagaatctcgaagtgcaggaggaagtcaccaagtccacgacc
acgccgattaccgtgggcgagaaccgctaccgcgtcaccgaggagcggcggctcatcgag
aaccaggccgtcgacatgatcgcgccggacatgccgaaggtcggcgggatgcgcgagacg
cgcaaggtcgccgatgtggcgaaccagtactacatcccggtcgcgatgcacaacgtctcc
tcgccgattgcgacgatggcgagcgcccacgtcggggcgtctgtcccgaactctctcgcc
gtcgagtaccactcctacgaactcggctggtgggaggacctagtcgaggagaccgtcatc
gaggacggctacatcgagattccggaagagccgggtctcggtctgacgctcgatctcgac
gccgtcgaagagcacgtcgtcgagggcgacaccgtcttcgacgaagcgtaa

DBGET integrated database retrieval system