KEGG   Halorhodospira halochloris: HH1059_21450Help
Entry
HH1059_21450      CDS       T06158                                 

Gene name
flrC
Definition
(GenBank) flagellar regulatory protein FleQ
  KO
K10943  two-component system, response regulator FlrC
Organism
hhk  Halorhodospira halochloris
Pathway
hhk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hhk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HH1059_21450 (flrC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hhk02022]
    HH1059_21450 (flrC)
Two-component system [BR:hhk02022]
 Other families
  FlrB-FlrC (polar flagellar synthesis)
   HH1059_21450 (flrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 AAA_5 HTH_30 HTH_28 AAA_30 AAA_16 AAA_19 Mg_chelatase HTH_23 MerR HTH_29 AAA MCM Sigma70_r4_2 HTH_24 GerE TsaE
Motif
Other DBs
NCBI-ProteinID: BAU58855
UniProt: A0A125T2T4
LinkDB All DBs
Position
complement(2365437..2366687)
Genome map
AA seq 416 aa AA seqDB search
MRDGAADFVAEQSAADELAAAVSRVTDNGPELIAEDKSSRQLIALAQRVAGKDVTVLLTG
ESGTGKEVFARYIHERSHRADGPFVAVNCAAIPENMLEALLFGFEKGAFTGANRSHSGKF
EQAQGGTLLLDEVSEIDLGLQAKLLRALQEKEIERLCGHKPIPLDVRVLASSNRDLRDFV
RLGKFREDLYYRLHVFPIHLPPLRDRLADIIPLAQSFALKYAQLGGAAGVEFTSDAQRKL
IQHTWPGNVRELENVVQRALILADGDKIDSGAIQFDPVSLEPQPQSVPDWTNEAVRAVEG
GPGALFEPNHAAKPWQPTIPKGIESAPVAPGYEEPHTPERSGQEASGQTLEEGLKTREYR
LILETLTAVGGNRKEAAARLGISSRTLRYKLARMRQEGVEVPDRGSASTNIYVYGN
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatggcgcggcagattttgtggccgagcaatcggcggcagatgagttggcggca
gccgtctcccgagtgactgacaacggcccggagctgatagccgaagataagagcagtcgg
caacttatcgcacttgcgcaaagagttgccggaaaagatgtgacggttttattgactggt
gagtccggcacgggcaaagaagtctttgcccgctacatacacgagcgctcccaccgggct
gatgggccttttgtggctgtcaactgtgcagcgatcccggagaatatgctggaggctctg
ctgtttggctttgaaaaaggcgcttttaccggggcgaaccgctcccactccggcaagttt
gagcaggcccagggcggaaccctgctgttggacgaggtctccgagatagaccttgggttg
caggcaaagctgctgcgtgcccttcaagagaaggagatcgagagactctgtggccataaa
ccgatcccgctcgatgtaagggtactagcgagcagcaaccgcgacttacgtgattttgtg
cggttgggcaaattccgagaggatctttactatcgcctccacgtattcccgatacatctg
ccccctctacgtgatcgactggcagacattatccccttggcccagtccttcgccctcaag
tacgcccaattgggtggggcagcaggggtagagttcacctccgacgcgcagcgcaagctc
attcagcatacttggcccggcaatgtccgtgaattggagaatgttgtccaacgggcattg
atactcgccgatggcgataaaatcgatagtggtgcgatccaattcgatccagtctcgctg
gagcctcagccgcagtcggtacctgattggacgaatgaggcagtgcgtgcagtagaaggc
ggcccgggggcgctgtttgagcccaatcatgctgctaagccgtggcaaccaacaatccct
aaaggaattgaatcggctccagtggctccgggatatgaggagccacataccccggagcgg
tcaggtcaggaagcttccgggcagactcttgaagagggtttgaagacccgcgagtatagg
ctaatccttgagacattgactgcggtaggcggcaatcgcaaagaggctgcagcccgtctt
ggtataagcagcaggacgttgaggtacaagctggcgcggatgcgtcaagaaggcgtcgaa
gtacccgaccggggcagcgcttcgactaatatctacgtctacggtaactga

DBGET integrated database retrieval system