KEGG   Halobacteroides halobius: Halha_0269Help
Entry
Halha_0269        CDS       T02401                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
hhl  Halobacteroides halobius
Pathway
hhl02020  Two-component system
hhl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Halha_0269
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Halha_0269
Bacterial motility proteins [BR:hhl02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Halha_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal DUF948 Ferritin KASH_CCD Laminin_II CK2S
Motif
Other DBs
NCBI-ProteinID: AGB40280
UniProt: L0K6Y5
LinkDB All DBs
Position
279534..281141
Genome map
AA seq 535 aa AA seqDB search
MQLIKKLKRRFGAMSFTKITVNRQFQIGLASLLILILLIGSFVLYNNRQMKQKVDYLNKK
VIPSVKVSDQIYRKLSKKIKIVYGKEAGNFVIGNAEISNEEYFNSIDKSIDKLKKYIQNE
DTLQVLNILESSNQKFKKLNADLQKTNDSMMRNIIIKDISNLDIPVTEANKILQDYTQGQ
LDRTINKIVKQSQKNRNRIIVITIVGMLMSFGLGIFINRQINNLTTGIKDKTNQAVDKAK
LVSDSAEEMKVIADDVENKITNASRKIKSLIEGNNEVSGAISEVATAIQDISSSIENLSS
QADDIAEVGEDTYQTMQTTNQRISSTNGIVQETVKKINDLQDSLSKIDQISDKIIKITEQ
TNLLALNASIESARAGKAGEGFAVVADEIKELADESKEATEEVKSFIEEIEGVTNEVIEK
MMSKKENSVIGSFKELQKLSNTVTEKMDNVIQVAEEQADSSQQVKELTEQISASSEEVSA
QTSEASNSSTEIAQFMEEVINGNNDLYFKIKEQVNVSKEQLELISDIVDANKRLK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaataaagaagctaaaaagaaggtttggtgcaatgagctttacaaaaataact
gtaaataggcaatttcaaataggactagcttcattattaattcttatattattaattggt
agttttgttttatataataatcgacaaatgaagcaaaaagtagattatttaaataagaaa
gtaattccttctgtaaaagtatctgatcaaatataccgaaaattatctaaaaaaattaaa
atagtttatgggaaagaagctggaaactttgttatagggaatgcagaaattagcaatgag
gaatattttaatagtatagataaaagtattgataaacttaaaaaatatatccaaaatgaa
gacactttgcaagtattaaatatcttagaaagctctaatcaaaaatttaagaaattaaat
gctgatttacaaaaaactaatgatagtatgatgcgcaatataattataaaagatataagt
aatttagatattccagttactgaagcaaacaagatattacaagattatactcaaggtcaa
ctggatagaacaattaataaaattgttaagcaatcacaaaaaaatagaaataggataata
gtaataactatagttggtatgttaatgagttttggtttaggaatatttatcaaccgtcaa
attaataacttaactacagggattaaagataaaactaatcaagctgttgataaagcaaaa
ttggttagtgattcagccgaagaaatgaaagtaattgctgatgatgtagaaaataaaata
accaatgcttctagaaagattaaaagtctaatagaaggtaataatgaggtctctggagca
attagtgaggttgcaactgcaattcaagatatatctagttcaattgaaaatctatcctcg
caagcagacgatattgctgaagtaggagaagatacttatcaaacaatgcaaactactaat
caaagaattagctctacgaatggaatcgttcaagaaacagttaaaaagataaatgactta
caggatagcttgagtaagattgatcagatttcagataaaattataaaaataacggaacag
actaatcttttagctttaaatgcttcaatagaaagtgctagggctggaaaagcaggtgaa
ggttttgcagtagtagcagatgaaataaaagaattagcagatgaaagtaaagaagctacc
gaagaagttaagagttttattgaagaaatagagggagtaactaatgaggtaatagaaaaa
atgatgagtaagaaagaaaatagtgttataggttcctttaaagaacttcaaaaattatca
aatacagttactgaaaagatggataacgtaattcaggttgcagaagaacaggctgattct
agtcaacaagtaaaagaattaacagaacaaatttctgcttctagtgaagaagtttctgct
caaactagtgaagcttctaattcatctactgaaattgctcaatttatggaagaagtaatt
aatggtaataatgatttatatttcaagatcaaagaacaagttaatgtctctaaggaacag
ttagaattaattagtgatatagtggatgctaataaaagattaaagtaa

DBGET integrated database retrieval system