KEGG   Halobacteroides halobius: Halha_0357Help
Entry
Halha_0357        CDS       T02401                                 

Definition
(GenBank) Cu/Zn superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hhl  Halobacteroides halobius
Brite
Enzymes [BR:hhl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Halha_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu TRAM_2
Motif
Other DBs
NCBI-ProteinID: AGB40359
UniProt: L0K7N8
LinkDB All DBs
Position
373186..373680
Genome map
AA seq 164 aa AA seqDB search
MNLLKRLFLGLSKVACAKVIGGPLAPKIEGRVYFREVSKGTIVTVRISGLPSYQPGEGGK
DPIGPHGFHVHERGNCEVGDPEDPFQAAGGHYNPHGEPHGNHAGDLPNLFSNNGVARMQV
FTNEFQPEDIIGRAVIIHQNPDDFRTQPAGDAGKRLACGIIKWC
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaatttattgaaaagattatttctaggattaagtaaagtagcatgtgctaaagtcata
ggaggaccactagcacctaagatagagggaagagtttattttagagaagtttctaaagga
actattgttacagttaggatatcggggctaccttcttatcagccaggagaaggaggtaaa
gatcctattgggccgcatggttttcatgttcatgagcgtggtaattgtgaagttggtgat
ccagaagatccttttcaggctgctggaggacattataatcctcatggtgagccacatggt
aatcatgcaggtgatctacctaatttattctctaataatggagtagctagaatgcaggtt
tttactaatgaatttcaaccagaggacataattggcagagcagtaattattcatcaaaat
ccagatgattttaggactcaacctgctggagatgcaggtaagagactagcttgtgggatt
ataaagtggtgttag

DBGET integrated database retrieval system