KEGG   Halobacteroides halobius: Halha_0948Help
Entry
Halha_0948        CDS       T02401                                 

Definition
(GenBank) Glutaredoxin, GrxC family
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hhl  Halobacteroides halobius
Brite
KEGG Orthology (KO) [BR:hhl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Halha_0948
Enzymes [BR:hhl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Halha_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox GIDA HI0933_like Thi4 FAD_binding_2 DAO FAD_oxidored NAD_binding_8 K_oxygenase Lycopene_cycl GST_N_3 SH3BGR FAD_binding_3 NAD_binding_9 Thioredoxin_3 GST_N_2 AlaDh_PNT_C FMO-like Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: AGB40909
UniProt: L0K981
LinkDB All DBs
Position
930550..931755
Genome map
AA seq 401 aa AA seqDB search
MSDNQPEIEIYTLTWCPYCRKAKSFFRSKDLAYTEYLIDEAEGKKEEMAKRSNGAKTVPQ
IFIDGQNIGGYDDLIELETTGKLNEMLGLEPVDLDQIWDLVIVGAGPAGLSAAIYGARKG
LEVLVLSLSLGGQVIETDIIDNWIGSPEITGGDLMESFWQHTQKYDVQAKLGAEVTNIRT
QDKLKVVETTQQEIETRSVIVATGTHNRSLGVPGEHELKGKGVHYCAICDGYLYAGDEVA
VVGGGNSGLEAALDMAKLDSKVNLIEVGDQLAGDEVLQEKVQANDLIEIYTGHGVEEITG
AKEVEEIVIRDTETGKYQTLSIKAVFVEIGLIPNSGFVDQLVATNQHNEIIVDQNNQTTV
EGIWAAGDVTDIKDKQIIVAAAEGAKAALRVNEYLQLNPED
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataatcaacccgagattgagatttatactttgacctggtgtccttactgtcgg
aaagcaaagtctttttttcgtagcaaagatctagcctatactgaatatttgattgatgaa
gcagagggtaaaaaagaagaaatggctaagaggagtaatggagctaagactgtgccacag
atatttattgatgggcaaaatattggtggttatgatgatttaatcgaactagagactact
ggtaaattaaatgagatgttaggtcttgagcctgttgatttggatcagatctgggattta
gtaattgtcggggctgggccagctggattgagtgcagctatttatggggcccggaaaggt
ctagaagtattagtcctttccttatctttagggggccaagttattgaaactgatataatt
gataattggattgggagtccggagataactggcggggatttaatggagtctttttggcag
catacccaaaagtatgatgttcaagctaagttaggagctgaagtaactaatattagaacc
caagataaactaaaagtagtagaaaccactcagcaggagattgaaacccgttctgtgatt
gtggctacaggaactcacaatcgtagtctaggtgttccaggagaacatgagttaaaagga
aaaggagttcattactgtgctatctgtgatggctatttatatgctggtgatgaggtagct
gtggtaggtggcggtaattctggtttagaagcagctttagatatggctaaactggatagt
aaagtcaacttgattgaggttggtgatcagttagctggtgatgaagttctccaagagaag
gtgcaagctaatgacttaatcgagatttataccggccatggagtagaagaaattacaggt
gctaaagaagtagaagagatagtaatccgggatactgagactggtaagtaccaaactctt
tctatcaaggcagtttttgtagaaattggtttaatccctaatagtgggtttgtagaccag
ctagtagctactaatcagcacaatgagattatagtggaccagaataaccagactactgta
gaaggaatctgggctgcaggagatgtaactgatattaaggataaacagataattgtagca
gctgctgagggagctaaggctgctctaagagtgaatgaatatttacaattgaatccagag
gattaa

DBGET integrated database retrieval system