KEGG   Halobacteroides halobius: Halha_1145Help
Entry
Halha_1145        CDS       T02401                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
hhl  Halobacteroides halobius
Pathway
hhl00500  Starch and sucrose metabolism
hhl01100  Metabolic pathways
hhl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Halha_1145
Enzymes [BR:hhl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Halha_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase IglC
Motif
Other DBs
NCBI-ProteinID: AGB41094
UniProt: L0K9P5
LinkDB All DBs
Position
1146948..1149497
Genome map
AA seq 849 aa AA seqDB search
MEFHGSFSVKSKLPNRIKKLKEVAYNLWWCWNHRAELLFSKIDDKLWKEFDRNPVKLLSK
VDQERLNKLASDNQFLVEYDQVISEFNDYLTTDDTWFKDVSPQWSEDEVIAYFSTEFGFH
ESIPIYSGGLGVLAGDHCKSASDLGLPLIGVGLLYHEGYFKQRITDKGWQESLYPTLDET
YLPITAVQDQEGNDLKVSVKLANREVLIKIWRLNVGRIKVFLLDTNIAENSSQDRELTSR
LYGGGEETRISQEIILGIGGTKGLAALGYDPVVWHMNEGHSVYLGLERIEELMTEESLSF
TEALEVVAASSVFTTHTPVPAGNEVFPFELKEKYFSEYWKRIGLTKEEFMNLGCVYDMEK
DDGFCLTVLALRLARFNNGVSKLHGEVSSQMWEDIWEGIPTDENPIDAITNGIHTLTWLA
PAWEELLDQYLPSDWRKRIEDKKMWQQVRNIPNKEFWQVHNQLKSKLIDYVREKDLARRK
RYNTLAKLDNNLLDKDKLTIGFARRFATYKRATLIFADLDRLNKICNKTGKEVQFIFAGK
AHPADVPGQELIKKIHEISQSEEFKGKVIILEDYDMNLARYLIQGVDIWLNNPRRPLEAS
GTSGQKVAANAGLNFSVLDGWWCEGYNKKNGWAIGYEIEYDDQEKQDQIDSNSLYQVLEE
EIVPLYYDNISQGIANDWIASMKEAMISNISVYSTDRMVQEYTKKLYLPAVKRKNEVEAN
EYALAKELVNWKEDLKENWEELKIKVRNKEKKEVYKVEDNINFSIEVDLASLELDDIDVE
LYIVAEKLEQPQIFVMDLEEKVSDNIYKYSLTLELSQLVGSGDYKYTFRVIPQDELLTTK
HELGLIKWI
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcacggtagtttttcagtaaaatctaaattacctaatagaatcaaaaaatta
aaagaagtagcttataacttatggtggtgttggaaccatagggctgagcttttattttcc
aaaattgatgataaattgtggaaggagtttgacaggaatcctgttaaacttctttctaag
gttgaccaagaaagattaaataagttagctagtgataatcaatttcttgttgaatatgac
caagttataagtgagtttaatgattatttgacaactgatgatacttggtttaaagatgtt
agtcctcagtggtctgaggatgaagtaattgcttacttttctactgaatttggatttcat
gaatcaatacctatctattctggtggtttaggagtattagcaggagatcactgtaaatca
gctagtgatttaggtctacctttaattggagtaggcttattatatcatgagggctatttt
aaacaaaggatcactgataaaggttggcaagaatcattatatcctactttagatgaaacc
tatttacctataactgctgtccaagatcaagaaggaaatgatttaaaggtcagtgttaaa
ttagcgaatagagaagtattaattaaaatttggaggttaaatgttggtaggataaaggtt
tttttgttagatactaatattgcagaaaatagtagccaagatagagaattaacttcacgc
ttatacggtggaggtgaggaaacaagaatatcgcaggagattattttaggtattggtggt
acaaaaggattagctgctttaggatatgaccctgttgtatggcatatgaatgaaggtcat
tcagtttatttaggattagagagaattgaagagttaatgacagaagaaagtttaagtttt
acagaggcattagaggttgtagcagcgagtagtgtatttactactcatactcctgtacca
gctggaaatgaagtttttccctttgaattaaaagaaaaatattttagtgaatattggaaa
agaataggcctaactaaagaagaatttatgaacttaggttgtgtctatgatatggagaaa
gatgatggtttttgtttaactgttttagctttgcgtttggcccggtttaataatggagtt
agtaagttacatggtgaagtttctagtcagatgtgggaagatatttgggaaggtatcccc
actgatgaaaatcctattgatgctattactaacggaattcatactttgacttggttagct
cctgcctgggaagaattattagaccaatatttacctagtgattggagaaaaaggattgaa
gataaaaagatgtggcagcaagttagaaatatacctaataaagaattttggcaagtgcat
aatcaattaaagagtaaattgattgattatgtaagagagaaggatctagctaggagaaag
agatataataccttagctaagctagataataatttattagataaggataaattaactata
ggttttgcacgtagatttgctacttataaacgagcaacattaatctttgcagatttagat
agattaaataagatttgtaataagacaggaaaagaagttcaatttatatttgctgggaaa
gcacatccagctgatgtaccgggccaagagttaattaaaaaaattcatgagattagccaa
agtgaagaatttaaaggtaaagtaataatcctagaagattatgatatgaatttggcccgg
tacctaattcaaggtgtggatatttggttaaataatccaagaaggccattagaagctagt
ggtactagtggtcaaaaagtagctgctaatgctggattgaattttagtgtacttgatggt
tggtggtgtgaaggatataataagaagaacggttgggctattggttatgagattgaatat
gatgatcaagaaaaacaagaccaaatagatagtaattctttatatcaagtattagaagag
gagattgttccactttattatgataatattagtcaagggattgctaatgattggattgca
agtatgaaagaagcaatgatttctaatatatcagtttatagtactgataggatggtacaa
gaatatacaaagaaattatatctgcctgctgttaaacgtaaaaatgaagtagaagctaat
gagtatgctttagctaaagaattagtcaattggaaagaagatttaaaagagaattgggaa
gaattgaagattaaggttcgaaacaaagagaaaaaagaagtttataaagtagaggataat
attaatttttctatagaagtcgatttagctagtttagaattagatgatatagatgttgag
ttatatatagtagctgaaaaattagagcaaccacaaatatttgtaatggatttagaagag
aaagtatcggataatatctataaatattctttaacattagagttatctcaattagtaggt
agtggagattataaatatacttttagagttattcctcaagatgaactattaactactaaa
catgaattaggtttaattaagtggatctaa

DBGET integrated database retrieval system