KEGG   Halobacteroides halobius: Halha_2301Help
Entry
Halha_2301        CDS       T02401                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hhl  Halobacteroides halobius
Pathway
hhl00970  Aminoacyl-tRNA biosynthesis
hhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Halha_2301
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hhl03029]
    Halha_2301
Enzymes [BR:hhl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Halha_2301
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Halha_2301
Mitochondrial biogenesis [BR:hhl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Halha_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGB42175
UniProt: L0KC97
LinkDB All DBs
Position
complement(2298673..2300118)
Genome map
AA seq 481 aa AA seqDB search
MLENYEITIGLEVHAQLDTDTKIFCGCKNEFGAEPNDHTCPICLGLPGTLPVLNKKAVDY
IIKAGLALDCEIATFSKFDRKNYFYADLPKAYQISQFDLPFCEDGAITIEVEENNYQIGI
TRIHLEEDAGKLTHAGDISSADSSLVDYNRVGTPLIEIVSEPDLHSPKQAVAYLKKLKSI
LEYIAVSDCEMAEGSLRADANLSIAPKGADELGTKTELKNMNSFKAIEKALTYEAKRQAK
VLAEGGTIIQGTRTWDGDAGKTLPLREKEEAHDYRYFPEPDLVPVIVKEEWVNEIETSIP
ELPDARQSRYVNELGIPEYDAGVITADREMADFFEAVVKNYEDAKEVSNWMMGQFSRLLN
EEDIEISKIKFAPQDLADLLTMMEEGTISRDIAREVFEDMFTTGKKPEAIVEEKGLKQIS
DEDELDNIVADVLADNQSAVDDYHGGNKNVIGFLIGQTMQASGGKANPQKVRELLQEKLE
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaactatgagattacaattgggttagaagttcatgctcaattagatacagat
actaaaatattttgtggatgtaaaaatgagtttggtgctgagcctaatgatcatacctgt
cctatatgtttaggtttacctgggacattacctgttttaaataaaaaagcagttgattat
attattaaagctggtttagctttagattgtgaaatagctacatttagtaagtttgaccga
aaaaattatttctatgctgatttgcctaaggcttatcaaatatctcaatttgatttacca
ttttgtgaggatggtgcaataactattgaagttgaagagaataattatcagataggaatt
actaggattcatctagaagaagatgcaggaaagttaacccatgccggtgatatttctagt
gcagattctagtttggttgattataatcgggtaggaacgcccctaattgagattgttagt
gaacctgatttacattctcctaaacaagcagttgcttatttaaagaaattaaagagtatc
ttagagtacatagcagtttctgactgtgaaatggcagagggttctttaagagcagatgcc
aacctttctatagctcctaagggtgcagatgaattaggaactaaaactgagctaaagaat
atgaattcttttaaagcaattgaaaaagctttaacatatgaagctaagcgtcaagctaaa
gttttagctgaaggtggcacaataattcaaggtacaagaacttgggatggagacgcagga
aagaccttgccactaagagaaaaagaagaagcacatgattatcgttatttcccagaacca
gatttagttccagtaattgtaaaagaagagtgggttaatgaaatagaaactagtattccg
gagttaccagatgctagacaatctcgctatgttaatgagttaggtattccggagtatgat
gctggagtaattactgctgatagagagatggctgacttctttgaagcagtagtaaaaaat
tatgaggatgctaaagaagttagtaattggatgatgggccaattctctcgtttattaaat
gaagaggatatagaaataagtaagattaaatttgcgcctcaagacttagctgatttatta
actatgatggaagagggtactatttctcgagatattgctagagaagtttttgaagatatg
ttcactacgggtaaaaagccagaagctattgtagaagaaaaaggtttaaagcagattagt
gatgaagatgaattagataatattgttgctgatgtgttagctgataaccaatcagcagta
gatgattatcatggtggaaataagaatgtaattggattcttaattggacaaacaatgcaa
gctagtggtggaaaagctaatccacaaaaggttagagagttattacaggaaaaactagaa
gagtaa

DBGET integrated database retrieval system