KEGG   Helicobacter heilmannii: BN341_12540Help
Entry
BN341_12540       CDS       T02626                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hhm  Helicobacter heilmannii
Pathway
hhm00620  Pyruvate metabolism
hhm00680  Methane metabolism
hhm01100  Metabolic pathways
hhm01120  Microbial metabolism in diverse environments
hhm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN341_12540
  09102 Energy metabolism
   00680 Methane metabolism
    BN341_12540
Enzymes [BR:hhm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BN341_12540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF1908
Motif
Other DBs
NCBI-ProteinID: CCM11488
LinkDB All DBs
Position
1121904..1123808
Genome map
AA seq 634 aa AA seqDB search
MVTNALMREVVAIQHHFVIDLYLKELDKLRRELSISVDFCPISATLQTDLKESYHKLDPT
SARLHPKEPFRAKLLLMQIKLKNRLIALNSPTPIGFSYQHASELVADIDLLLENLEPSLQ
GSMRRFKNLVLLTGFHLLSLDFREHRAVFVNALSEVFSLLSLATDFYALPEEQKLEVLNH
ALELEPISFWALLPQVSAECKRLLEGFLTMLWAQCKITKNAFSSVIISMTTQASDLLAVL
WLVKQVGLEKDLYITPLFETIEDLDHAPTILKTLHGNPHYKAYLQGMQNTQEIMVGYSDS
SKDGGIFASNYNLHMAICQLVALGQELGIEFILFHGRGGSVSRGGGSLEDALLSAPLFSV
QDTLKLTEQGETISSRYLNNTSALSNLSNIVGALLKKSLYDKRGLSKNPINPDTKELLQT
LSKISYTAYRQLYTMHGFLEYFKQATPIAFIQELNLGSRPAKRKEGTKLEDLRAIPWVFA
WTQNRSILPAWFGVGSALKGVALADLQACYLEGGFFKVVIDNIAQVLLKVDLGIAKQYHA
FASSVPNATEILAQIESEFVTSLERILAIRQENALLEKDGIVRQGILFRTPYINALSCLQ
IELIKAFKQDPKDQVKLAIQSTLIGIAQGLRNTG
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggttaccaatgccctcatgcgtgaagttgtggcgatccaacaccattttgtcatcgac
ctctatctcaaagagctggataaattgcgccgtgagctctccatctctgtggatttttgc
cccatctctgctaccctgcagacggatttaaaggaatcttatcacaaactagaccccacc
agcgcaaggctacaccccaaagaaccttttcgtgccaagttgcttttaatgcaaatcaaa
ctaaaaaaccgcctcatcgccctaaattcgcccacacccatcggctttagctaccaacat
gccagcgaacttgttgccgatattgatttgcttttagaaaacttagaaccaagcttgcaa
ggctcgatgcgccgttttaaaaatttagttttgctaacaggctttcatttactcagcctt
gattttagagaacatcgggcagtgtttgtcaacgcccttagcgaggttttttccctgctc
tctcttgccaccgacttttacgccttgcctgaagaacaaaagctagaagtcctaaaccac
gctctagagctagaacccatctccttttgggctctgctgccacaggtgagcgcagagtgt
aaacggctactagaaggctttttaaccatgctttgggcgcagtgcaaaatcactaaaaac
gccttttcaagtgtcattatctccatgacaacacaggcaagcgacttattagcggtgctc
tggctggttaaacaagtggggctagaaaaggatttatacatcactcccttatttgaaacc
attgaggacttagatcacgcccccacgattttaaaaaccctgcatggcaacccccactac
aaagcctatttgcagggcatgcaaaacacccaagaaatcatggtgggctactcagattca
agcaaggatggggggatttttgcgagcaattataatttacacatggccatctgccaatta
gtcgctctaggccaagagcttggcattgagttcattttgttccatgggcggggagggagt
gtaagccggggtggggggagcttggaggacgctttattaagtgctccgctttttagcgta
caagacaccttaaaactcaccgagcagggcgaaaccatcagctcaaggtatcttaacaac
acgagcgcgctgagtaatttgtctaacattgtgggggcattgttgaaaaagtcactctat
gacaaacggggcctgtctaaaaatcccatcaaccccgatactaaagagctcttacaaaca
ctctccaaaatctcctacactgcctaccgccaactctacaccatgcacggttttttggag
tacttcaagcaagccacccccatcgccttcatccaagaactcaatctaggctcacgccca
gccaagcgtaaggaaggcacgaaattagaggatttacgggcgatcccatgggtctttgca
tggacgcaaaatagaagcattttaccggcgtggtttggggtgggcagtgcgcttaagggt
gtagctttagctgatttacaagcctgctatcttgagggtgggttttttaaggtggtgatc
gacaatatcgctcaggtgcttttaaaggtggatttaggcattgctaaacaataccacgcc
tttgcgagcagtgtgccaaatgccacagagattttggcgcagattgaaagcgagtttgtc
acaagcttggagcgtattttggccatccgccaagaaaatgccctattggaaaaagacggg
attgtaaggcaggggattttgtttagaaccccctacatcaatgcgctcagctgcttacaa
attgagctcatcaaggccttcaaacaagaccccaaagaccaagtgaaactcgccatccaa
agtacgcttatcggcatcgctcaagggttacgcaatacaggctag

DBGET integrated database retrieval system