KEGG   Helicobacter heilmannii: BN341_15240Help
Entry
BN341_15240       CDS       T02626                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hhm  Helicobacter heilmannii
Brite
KEGG Orthology (KO) [BR:hhm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hhm03012]
    BN341_15240
   03029 Mitochondrial biogenesis [BR:hhm03029]
    BN341_15240
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhm04147]
    BN341_15240
Translation factors [BR:hhm03012]
 Eukaryotic Type
  Elongation factors
   BN341_15240
 Prokaryotic Type
   BN341_15240
Mitochondrial biogenesis [BR:hhm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BN341_15240
Exosome [BR:hhm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BN341_15240
  Exosomal proteins of breast cancer cells
   BN341_15240
  Exosomal proteins of colorectal cancer cells
   BN341_15240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: CCM11256
LinkDB All DBs
Position
1376593..1377792
Genome map
AA seq 399 aa AA seqDB search
MAKAKFERNKPHVNVGTIGHVDHGKTTLSAAISAVLSLKGLAELKDYDNIDNAPEEKERG
ITIATSHIEYSTENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKQDMVDDQELLDLVEMEVRELLSTYEFPGDDTPIVAGSALKALE
EAKSGNIGEWGQKVLKLMEEVDKYIPTPKRDIEKAFLMPVEDVFSIAGRGTVVTGRIERG
TVKLQDEVEIVGIKPTQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVFRGMVLCK
PGSITPHKKFEGEVYVLSKEEGGRHTPFFNGYRPQFYVRTTDVTGSITLPEGTEMIMPGD
NTKIVVELISSIALELGTKFAIREGGKTVGAGVVTKIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctaagtttgaacgaaacaaaccccatgtcaacgtgggcaccatcgggcat
gttgaccatggtaaaaccactttaagcgcggcgatctctgcggtgctctctttaaaaggg
ctggccgaacttaaagattacgacaatattgacaacgcccccgaggaaaaagaaaggggc
atcaccatcgccacttctcacattgagtactccacagaaaaccgccactatgcgcatgtg
gattgtcccggccacgccgactatgtgaaaaacatgatcaccggtgccgcccaaatggat
ggcgcgatcttagtggtgtctgctgccgatggccccatgccccaaacccgcgaacacatt
ctactagcccgccaagtgggtgtgccctacatcgtggtgttcttaaacaaacaagacatg
gtcgatgaccaagaattattagacttggtggaaatggaagtgcgcgaacttttaagcacc
tatgaattccccggggatgacacccccattgtggccggatctgcgcttaaagccttagaa
gaggccaaatctggcaacattggcgaatggggacaaaaagtgctcaagctcatggaagaa
gtggataaatacatccccactcctaagcgtgacatagaaaaagccttcttaatgcccgta
gaggatgtgttctccattgccgggcggggcaccgtggtgaccggtcgtattgagcgtggc
actgtgaaactccaagatgaagtggaaattgtgggcattaaacccacccaaaaaaccact
gtgaccggtgtagaaatgttccgcaaagaactcgaaaaaggcgaagccggcgacaatgtg
ggcgtgcttttgcgtggcactaaaaaagaggaagtctttaggggcatggtgctttgcaaa
cccggctccatcaccccccataaaaaattcgagggcgaagtgtacgtactctctaaagag
gaaggcggtcgccatacgcctttcttcaacggctaccgcccgcagttttatgtccgcacc
accgatgtgaccggctctattactttgcccgaaggcacagagatgatcatgccaggagac
aacactaaaatcgtagtggagctcatcagctctattgccctagaacttgggacaaaattt
gcgatccgtgaaggcggtaaaaccgtgggcgcgggtgtggttaccaaaatcatcgagtag

DBGET integrated database retrieval system