KEGG   Helicobacter heilmannii: BN341_15610Help
Entry
BN341_15610       CDS       T02626                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hhm  Helicobacter heilmannii
Pathway
hhm00473  D-Alanine metabolism
hhm00550  Peptidoglycan biosynthesis
hhm01100  Metabolic pathways
hhm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hhm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN341_15610
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN341_15610
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BN341_15610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hhm01011]
    BN341_15610
Enzymes [BR:hhm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BN341_15610
Peptidoglycan biosynthesis and degradation proteins [BR:hhm01011]
 Precursor biosynthesis
  Amino acid ligase
   BN341_15610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp GARS_A ATP-grasp_3 ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: CCM10830
LinkDB All DBs
Position
complement(1432307..1433350)
Genome map
AA seq 347 aa AA seqDB search
MDYGLLFGGQSFEHEISIVSAIALKEVLGASIKAFIFLDGAHKFYLIEPKDMRAPFFSRG
QYKKCPEITLKMHGFYTQGLLGSKKVAFNTLINLIHGADGEDGKLASLLDFFSVKFIGPR
VEASVLSFNKHFTKMLAKEKGINTLPYVFLNNHNEHNLKSMDYPLIVKPNRLGSSLGIGV
IKEEREVAFLLDEVFEFDSEVLIEPFKEGVKEYNLAGCKIQEKGESVFVFSTIEEPQKKA
FLSFEEKYLDFGRTAKVARAELSPVLEEKMHAVFQALYDPLFVGAIIRCDFFVIGNEVYL
NEINPIPGSLAHYLFEDFAHILERVQLPKPTPIPITYNYINRIQKAK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggattatgggctattgtttggcggtcaaagttttgagcatgagatcagcattgtgagc
gcaatcgcgcttaaggaagtgctgggcgcatccatcaaggcttttatctttttggatggg
gcgcataaattctatttgatcgaacccaaggacatgcgcgcgccattcttttctagaggg
caatataaaaaatgccccgagatcaccttaaaaatgcatggcttttacacgcaaggttta
ttaggttctaagaaagttgccttcaacacgctcattaacctcatccacggggcggatggc
gaggatggcaaactcgcttctttgctggacttctttagcgtgaagttcatcggccctagg
gtggaggcaagtgtgcttagttttaacaaacacttcactaaaatgctcgccaaagaaaaa
ggtatcaacaccctgccctatgtgtttttaaacaaccacaacgaacacaatctaaagtcc
atggactacccgctcattgtcaagcccaaccgcctgggcagctctcttggcatcggggtg
attaaagaggagcgcgaagttgccttcttgctggatgaagtgtttgaatttgacagcgag
gtgctgatcgagccctttaaagagggggtgaaggagtacaacctggccgggtgcaaaatc
caagagaagggagaaagcgtgtttgttttctccaccatcgaagagcctcaaaaaaaggcg
tttttgagctttgaggaaaagtatttggattttggacgcaccgctaaggtggcaagggct
gaacttagccccgttttagaggaaaaaatgcacgctgtgtttcaagccctttacgacccg
ttatttgtgggggcaatcatccgttgtgacttctttgtgatcggcaacgaagtctattta
aacgagatcaacccgattccaggcagcctcgcgcactacctctttgaagacttcgctcat
atcctggagcgtgtacaactgcctaaacccacccccatccccatcacttataactacatc
aaccgaatccaaaaagccaagtaa

DBGET integrated database retrieval system