KEGG   Helicobacter heilmannii: BN341_17720Help
Entry
BN341_17720       CDS       T02626                                 

Definition
(GenBank) Menaquinone via 6-amino-6-deoxyfutalosine step 2
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
hhm  Helicobacter heilmannii
Pathway
hhm00130  Ubiquinone and other terpenoid-quinone biosynthesis
hhm00270  Cysteine and methionine metabolism
hhm01100  Metabolic pathways
hhm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BN341_17720
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BN341_17720
Enzymes [BR:hhm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     BN341_17720
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     BN341_17720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: CCM73703
LinkDB All DBs
Position
1612337..1612849
Genome map
AA seq 170 aa AA seqDB search
MILHHKVQALIFSGVAGGLAPNLAINDLLLATKLCQADIDLTSFNHPLGFIPESSVFVES
DPQLNALAKSVAQNLNLPLKEGIIATCDQFVSDLKRKQTFVQHFGASVVEMEGASLGFVC
RDFNIPFCVLRSVSDTADGTAPADFDAFLHQSAQISADFVYAMLWALAQN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
ttgatcttgcaccacaaggtccaagctttgatctttagtggcgtggcaggaggcctagcc
cctaatttggccatcaacgacctgcttctagccaccaagctgtgtcaagccgacatcgac
ctcacctcttttaaccaccctttaggcttcatccctgaaagcagtgtatttgtagagagc
gacccacagctcaacgccctagctaaaagcgtggcgcaaaatttaaatctcccacttaag
gagggcatcatcgccacttgtgatcagttcgtaagcgatcttaaacgcaaacaaaccttt
gttcagcactttggggcgagtgtggtggagatggagggggcgagtttaggctttgtgtgc
cgcgatttcaacatccctttttgcgtgctaaggagtgtgagcgacacagccgatggcact
gctcccgcggactttgatgcattcttgcaccaaagcgcgcaaatcagtgcagactttgtc
tatgccatgctttgggcattggcgcaaaactaa

DBGET integrated database retrieval system