KEGG   Helicobacter heilmannii: BN341_4630Help
Entry
BN341_4630        CDS       T02626                                 

Definition
(GenBank) Type II restriction enzyme MjaIII
Organism
hhm  Helicobacter heilmannii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C
Motif
Other DBs
NCBI-ProteinID: CCM12172
LinkDB All DBs
Position
404896..405750
Genome map
AA seq 284 aa AA seqDB search
MTNPVPFTEFLATLQKTNRTLDFFVDWQKCLENQDKIRICCNHLNLLLGVRAEDLFAKVH
LLFQEYPRAFQILPLLLAININDAKKQRAEMIVLTPTKEERYLSYYWESPQAICTFLQES
GLLQILSAGHLHDLNDFVFGIEVGLDSNARKNRSGKWMEKHLESALKQAKLNFKAQVSVT
EFKDLHASFGNDIKKFDFVIYGAQTTYFIECNFYSSGGSKLNEVARAYLELTPRFAKHPH
KEFIWITDGQGWMDAKNKLQEAYKSVRVYNLSRLNSLLGELSHA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccccgtgccttttacagaatttttagccactctccaaaagacgaaccggaca
ctagattttttcgtggattggcaaaagtgcctagaaaatcaagataagattcgcatttgt
tgtaaccacttaaatctgttactgggtgttagagcagaagatttgtttgcaaaagttcat
ctacttttccaagaataccctagagccttccaaatcctgcctttattgctcgccataaac
attaacgatgccaaaaagcaaagggcagagatgattgtgctaacccctacaaaagaagag
agatatttaagttactactgggaaagcccacaagccatttgcacctttcttcaagaaagc
gggcttttgcagattttgagtgctgggcatctccacgaccttaatgattttgtttttggg
atcgaagttggactagacagcaacgcgcgtaaaaaccgcagcgggaagtggatggagaaa
cacttagaaagtgctttaaaacaagccaagcttaattttaaagcacaggtgagtgttaca
gaatttaaggacttgcacgccagctttggcaacgacattaagaaatttgactttgtgatc
tatggcgcacagacaacctattttatcgagtgcaatttttacagcagtggggggagcaag
ttaaacgaggtcgcgcgggcgtatttggagcttaccccccgctttgccaagcacccgcat
aaagagtttatttggatcacggacgggcaggggtggatggatgctaagaataaattacaa
gaggcctataaaagcgtgcgtgtctataatctaagccgattaaatagcctcttaggggag
ctaagccatgcttag

DBGET integrated database retrieval system