KEGG   Helicobacter heilmannii: BN341_7120Help
Entry
BN341_7120        CDS       T02626                                 

Definition
(GenBank) Biotin carboxylase of acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
hhm  Helicobacter heilmannii
Pathway
hhm00061  Fatty acid biosynthesis
hhm00620  Pyruvate metabolism
hhm00640  Propanoate metabolism
hhm01100  Metabolic pathways
hhm01110  Biosynthesis of secondary metabolites
hhm01120  Microbial metabolism in diverse environments
hhm01130  Biosynthesis of antibiotics
hhm01200  Carbon metabolism
hhm01212  Fatty acid metabolism
Module
hhm_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hhm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN341_7120
   00640 Propanoate metabolism
    BN341_7120
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BN341_7120
Enzymes [BR:hhm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BN341_7120
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BN341_7120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_C Biotin_carb_N Dala_Dala_lig_C ATP-grasp RimK ATPgrasp_ST ATP-grasp_3 LAL_C2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: CCM11947
LinkDB All DBs
Position
651344..652708
Genome map
AA seq 454 aa AA seqDB search
MEKEIQRILIANRGEIVLRAIRTIAQMGKQSIAIYSSADKDAHYLDTADAKVCVGGPKSA
ESYLNIPAIISAAELFEADAIFPGYGFLSENQNFVEICTHHGLEFIGPSAEVMALMGDKS
KAKACMQQAGVPVIEGSNGTLKSYEEALEVAERIGFPIIIKAANGGGGRGMRVVEKPSAL
KNLYLAAETEALSAFGDGSVYIEKFIENPKHIEVQILADKHGNVVHVGERDCSTQRRQQK
LIEETPASVLKEEVRQRLLKTAINAAKHIGYVGAGTFEFLLDVNGQDFYFMEMNTRLQVE
HTVSEMVSGLDLVEWMVRIAQGETLPSQESIRCQGHAIECRITAEDPKTFTPSAGKITSW
VAPGGMGVRFDTHAYADYKVPPYYDSMIGKLIVHAPTREQAITKMKRALTELHVEGIKTT
RDFHLAMLDNPDFRHNKIHTKYLETQQRNLNVRR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaaatccagcgcattttgatcgctaacagaggagagattgtactccgagca
attcgcaccatcgctcaaatgggcaagcaatctatcgccatttactccagtgccgacaag
gacgcgcattatcttgataccgctgatgcgaaggtatgcgtgggcgggcctaagtcagca
gaaagttatttgaatatcccagcgatcatcagtgccgccgagttgtttgaggcggatgcg
atcttccctggatatgggttcttaagcgagaaccaaaactttgtagaaatctgtacccac
cacgggctagagttcatcggccctagtgccgaggtaatggctttaatgggggacaagtcc
aaagccaaggcgtgcatgcagcaggcgggtgtacccgtgatcgagggctctaatggaact
ttaaagagctatgaagaagccctagaggtggctgagcgcatcggttttcccatcatcatc
aaggcggccaatggcggaggtgggcggggcatgcgtgtggtggaaaaacccagcgcgctt
aaaaacctctacctagccgctgaaaccgaggctttaagtgcctttggagatggcagcgtt
tatattgaaaagttcatcgaaaaccccaagcacatagaagtgcagattttagccgacaaa
catggcaatgtagtccatgtgggcgagcgggattgctccacacagcgacgccagcaaaaa
ctcattgaagagacccccgcttcggtgctcaaagaggaggtacgccaaaggctcttaaag
accgccatcaatgccgccaagcatataggctatgtgggggcggggacttttgagttcttg
ttggatgtgaatgggcaggatttttatttcatggagatgaacacccgcttgcaagtggaa
cacacagtgagcgaaatggtgagtggcttggatctcgtggagtggatggtgcggatcgcc
caaggtgaaactttaccttcccaagagtccatccgctgccaagggcatgccatcgagtgc
cgcatcactgccgaagatcccaagaccttcacgccaagtgccggtaaaatcacctcgtgg
gttgctcccgggggaatgggggtgcgctttgacacccacgcttatgcggattataaagtc
ccgccctattacgattcgatgattggcaagctcatcgtgcacgcccccactagagagcag
gccatcaccaaaatgaagcgggcgttaacagagcttcatgtcgaggggatcaagacaaca
agagattttcacctagccatgctagataaccccgactttaggcacaataaaatccatacc
aagtatttagaaacccaacaaaggaatcttaatgtacgcagatag

DBGET integrated database retrieval system