KEGG   Haloarcula hispanica N601: HISP_12000Help
Entry
HISP_12000        CDS       T02949                                 

Definition
(GenBank) DNA polymerase
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
hhn  Haloarcula hispanica N601
Pathway
hhn03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hhn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    HISP_12000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hhn03032]
    HISP_12000
Enzymes [BR:hhn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HISP_12000
DNA replication proteins [BR:hhn03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     HISP_12000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2
Motif
Other DBs
NCBI-ProteinID: AHB66691
UniProt: V5TMZ7
LinkDB All DBs
Position
1:complement(2280976..2283783)
Genome map
AA seq 935 aa AA seqDB search
MSDGTQGTLGDFEQDADEDRPVADEAAAIAGNGGSDTGGTSVVDIDERQFPPVEETVEFV
VTQVDYTIEGQGDDEFPVVHVFGRTDDNEPIHARVFDFKPYFYAPTDSVTEDELRQYDSI
TDWKAADEDGEPYESIRGERLTKIFGQTPRDVGQIRDDFDHYEADILFPNRLLIDKDITS
GVRVPARELDDGSLKVHHEEITPVEAHAEPRVNTFDIEVDDRHGFPEDGEEPIICLTSHD
SYRDEYVVWLYESPDGINGPEALAGYEPIREDFEADVRVFDEEEAMLEAFVDYIVDTDPD
VLTGWNFDDFDAPYFLDRLEELQSYNHDFDLQIDRLSRVDEVWRSGWGGPDIKGRVVFDL
LYAYKRTQFTELESYRLDAVGEQELGVGKERYTGDIGDLWEQDPEQLLEYNLRDVELCVE
LDREQDIIDFWDEVRTFVGCKLEDATTPGDAVDMYVLHKLHGEFALPSKGQQESEDYEGG
AVFDPITGVRENVTVLDLKSLYPMCMVTTNASPETKVDPDAYDGDTYRAPNGTHFRKEPD
GVIREMVDELLSEREEKKTKRNEFDPENPDYGRLDRQQAAVKVIMNSLYGVLGWDRFRLY
DKEMGAAVTATGREVIDYTDEVVADEGYEVVYGDTDSVMLQLGDVGPNDVEGDVEITDEM
REKHPEMGDDELELIATTIQKGFELEETINASYDEFAMEQLNAEFHRFEIEFEKLYRRFF
QAGKKKRYAGNIVWKEGKHVDDIDITGFEYQRSDIAPITKRVQKEVIDRIVRGEDAESIK
QYVSDVIEDYQDGNVNYDDVGIPGGIGKKLDNYDTDTAQVRGAKYANLLLGTNFQSGSKP
KRLYLDRVHSDFFQRIEDEEGLDPQRDPLYGEFRRDPDVICFEYADQIPEEFEIDWDKML
DKTLKGPIARILEAMDISWEEVKSGQEQTGLGSFM
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgggacccagggcacgctgggggatttcgagcaagacgcggatgaggaccgc
ccggtcgccgacgaagcggcggccatcgcgggcaacggtgggagtgacaccggcgggacg
agcgtcgtcgacatcgacgagcgccagttcccgccggtcgaggagaccgtcgagttcgtc
gtcacgcaggtcgattacaccatcgaagggcagggcgacgacgagttcccggtcgtccac
gtcttcgggcgtaccgacgacaacgaaccgatccacgcgcgggtcttcgatttcaagccg
tacttctacgcgccgaccgacagcgtcactgaggacgaactccgccagtacgacagcatc
accgactggaaagcggccgacgaggacggcgagccctacgagtcgattcgcggcgagcgc
ctgacgaagatattcggccagacgccccgcgacgtgggccaaattcgtgacgacttcgac
cactacgaggcggacatcctctttcctaaccgcctgctcatcgacaaggacatcacgagc
ggcgtgcgcgtccccgcccgcgaactcgacgacggcagcctgaaagtccatcacgaggag
ataacgccggtcgaagcccacgccgagccgcgggtcaacaccttcgacatcgaggtagac
gaccgccacggcttccccgaggacggcgaggagccgatcatctgtctcacctcccacgac
tcctaccgcgacgaatacgtcgtctggctgtacgagtcccccgacggcatcaacggtccc
gaggcgctggccggctacgagccgattcgggaagatttcgaggccgacgttcgggttttc
gacgaggaggaggccatgctggaggcctttgtcgactacatcgtcgacacggaccctgac
gtgctgactggctggaacttcgacgacttcgacgcgccgtacttcctcgaccggctggag
gaactccagagctacaaccacgacttcgacctccagatagaccgcctctcgcgggtcgac
gaggtctggcgctcgggctggggcggcccggacatcaagggccgggtcgtcttcgacctt
ctctatgcctacaagcgcacccagttcaccgaactcgaatcctaccggctcgacgccgtc
ggcgagcaggaactcggcgtcggcaaggaacgctacaccggcgacatcggcgatctctgg
gaacaggaccccgagcagctactggagtacaacctccgggacgtggagctgtgtgtcgaa
ctcgaccgcgagcaggacatcatcgacttctgggacgaagtccgtaccttcgtcggctgc
aaactggaagacgccaccacgcccggcgacgccgtcgacatgtacgtcctccacaagctc
cacggcgagttcgcgctcccctcgaaaggccaacaggagagcgaggactacgagggcggg
gccgtgttcgaccccatcaccggcgttcgtgaaaatgtcacggttctagacttgaaatca
ttgtacccgatgtgcatggtgacgactaacgccagcccggagacaaaggtcgaccccgat
gcctacgacggcgacacctaccgcgcgcccaacggcacccactttcggaaagaaccggac
ggcgtcatccgggagatggtcgacgaactcctgtcagaacgagaggaaaagaagaccaag
cgaaatgaattcgatcccgaaaacccggattatgggcgcttagaccgccagcaagcggca
gttaaggtgataatgaactcgttatacggcgttttgggatgggatcgcttccgcctctac
gacaaggagatgggagccgccgttaccgccaccggtcgcgaggtcatcgactacaccgac
gaagtcgttgccgacgaggggtacgaggtcgtctacggcgacaccgactccgtcatgctc
cagcttggcgatgtgggtcccaacgacgtagaaggcgacgtcgaaatcaccgacgagatg
cgcgagaagcaccccgaaatgggtgacgacgaactcgaactcatcgccacgaccattcag
aaagggttcgagctggaggagacgatcaacgcctcttacgacgagttcgcgatggagcag
ctcaacgccgagttccaccgcttcgagatcgagttcgagaagctctaccggcggttcttc
caggcggggaaaaagaagcgctacgcgggcaacatcgtctggaaggagggcaagcacgtc
gacgacatcgacatcacgggcttcgagtaccagcgctcggatatcgcccccatcaccaaa
cgggtccagaaagaggtcatcgaccgcatcgtccgcggtgaggatgccgagtccatcaag
cagtatgtcagcgatgttatcgaggattatcaggacggcaacgtcaactacgacgacgtg
ggcattcccggcggcatcgggaagaaactcgacaactacgacaccgacaccgcacaggtc
cggggcgcgaagtacgccaacctcctgctggggacgaatttccagagcgggtcgaagcca
aagcggctgtatctcgaccgagtccactcggatttcttccagcgaatcgaggacgaggag
gggctggacccccagcgggacccgctgtacggcgagttccgacgggaccccgacgtgatc
tgcttcgagtacgcggaccagattcccgaggagttcgaaatcgactgggacaagatgctc
gataagacgctgaaaggcccgattgctcggattctggaagccatggatatctcttgggag
gaggtcaagtccggtcaggaacagacgggactcgggagcttcatgtaa

DBGET integrated database retrieval system