KEGG   Haloarcula hispanica N601: HISP_12555Help
Entry
HISP_12555        CDS       T02949                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hhn  Haloarcula hispanica N601
Pathway
hhn00564  Glycerophospholipid metabolism
hhn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HISP_12555
Enzymes [BR:hhn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HISP_12555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 FAD_binding_2 Pyr_redox_2 Pyr_redox FAD_oxidored Thi4 NAD_binding_7 HI0933_like Lycopene_cycl GIDA 3HCDH_N NAD_binding_8 Pyr_redox_3 ApbA PALP TrkA_N
Motif
Other DBs
NCBI-ProteinID: AHB66797
UniProt: V5TPB2
LinkDB All DBs
Position
1:2393695..2394918
Genome map
AA seq 407 aa AA seqDB search
MAIETDVLVVGGGATGAGVARDLALRGIDVTLVERDGLTSGTSGRSHGLLHSGARYAEAD
RVGAEECITENRILKDIAGACIRDTGGLFVQLAGDDPDYFEAKRAACEDIGIPVETLDSD
AAQERVPDLAAEVERAFEVPDAVIYPSRLVAANAADARDHGATIHPHAPVEDVLVEDGQV
TGVRVGGAINDTIEADYVVNATGAWAGQFAAMADLDVEMQPTRGVMVSVEYDDLGPVLNR
CRDPDDGDIVVPHEREAVLGTTSVPVRDPDEYETEQWEIEESIEECAAMLPPVADAPEVR
TWWGVRPLYAPDEDERGGRGISRGFFLLDHADDGVDNMASIVGGKLTTYRQMAEATADLV
CDGIGVDADCRTADRRLPSVDDPAQLDALVAEFDGQGPTDEDVVGSV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgagacggatgtcctcgtcgtcggtggtggcgcgaccggcgctggcgtcgct
cgtgacctcgcactccgtggcatcgacgtgacgcttgtcgagcgtgacgggctgacaagc
ggtacctccggacgctcgcacgggttgctgcacagcggtgcccgctacgccgaggcagac
cgggtcggtgccgaggagtgcatcaccgaaaaccggatactcaaggacatcgccggggcc
tgcatccgcgacaccgggggcctgttcgtccaactcgccggggacgaccccgactacttc
gaggccaaacgggcggcctgtgaagacatcggcatccccgtcgagacgctggacagcgat
gcagcccaagagcgggtgcccgacctcgccgcggaggtcgagcgcgcgttcgaggtccct
gacgccgtcatctacccgtcgcgcctggtcgccgcgaacgccgccgatgctcgcgaccac
ggcgcaacgatacacccgcacgcacctgtcgaggacgtgctcgtcgaggacggacaggtg
accggcgtgcgggtcggtggggcaatcaacgacactatcgaggccgactacgtcgtcaac
gcgaccggtgcctgggcgggccagttcgccgcgatggccgacctcgacgtcgagatgcaa
ccgacgcggggcgtgatggtctccgtcgagtacgacgacctcgggccggtactcaaccgc
tgccgggaccccgacgacggcgacatcgtcgtgccacacgagcgcgaggccgtcctcggg
acgacgagcgtgccggtccgcgacccggacgagtacgagacggagcagtgggaaatcgaa
gagagcatcgaagagtgtgcggcgatgctgccgccagttgcagacgcccccgaggtccga
acctggtggggcgtccggccgttgtacgccccagacgaggacgagcgcggcggccgcggc
atctcgcgtggcttcttcctgctcgaccacgccgacgacggcgtcgacaacatggcgagc
atcgtcggcggtaaactgaccacctaccggcagatggccgaggcgacggccgacctcgtc
tgtgacggcatcggcgtcgatgcggactgtcggactgcggaccgaaggctcccgagcgtc
gacgacccggcgcagttggacgcgctcgtggccgagttcgacggtcagggaccgaccgac
gaggacgtggtcgggtcggtgtga

DBGET integrated database retrieval system