KEGG   Hydrogenobaculum sp. HO: HydHO_0127Help
Entry
HydHO_0127        CDS       T02482                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
hho  Hydrogenobaculum sp. HO
Pathway
hho00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hho01100  Metabolic pathways
hho01110  Biosynthesis of secondary metabolites
hho01130  Biosynthesis of antibiotics
hho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HydHO_0127
Enzymes [BR:hho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     HydHO_0127
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     HydHO_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT CorA YscO TPD52
Motif
Other DBs
NCBI-ProteinID: AGG14464
UniProt: M1RI52
LinkDB All DBs
Position
complement(113290..114360)
Genome map
AA seq 356 aa AA seqDB search
MTKELEDLRSEIDKIDAKIVELLNKRADIAKKIGEIKKQQNIQVRNLQREKEVISNVIKE
NEKYGLFPKEALEIIYKEIISAISSLEGAVKIAYFGPKATFTHQAAISHFGLSSDYIACD
SISTVFELVESGNAHYGVVPIENTIEGIVNHTIDLLMDADLFIVGEIIIPINLFLLSLER
DIAKISKVYSHKHALAQSRKFLEKHLPFAEILEAKSTANACEIAQKEPGTAAIASEVAAY
VYGLNILAKNIQDQKNNFTRFLIIGKTLTKPTGKDKTSIIMGVKNQTGALYKALEIFYRH
NINLTKIESRPSKKKAWDDIFYVDMEGHIEDKNVKEALEELDKNSHMIKFLGSYPR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagagttagaggatttaagaagcgagatagacaaaatagacgcaaaaatagta
gagcttctaaacaaaagagctgatattgcaaaaaagataggagaaataaaaaaacagcaa
aatatacaagttaggaacttacaaagggaaaaagaagttatatcaaacgtaataaaagaa
aatgaaaaatacggtttgtttccaaaagaagcactggaaataatatataaagagattata
tctgccatatcatctttggaaggagctgtaaagatagcctactttgggccaaaagcaacg
tttacccatcaggcagccatatcccattttggattatcttctgattatattgcctgcgat
tctatctctacagtttttgagcttgtagaatcgggaaacgcccattacggagtagtgccc
atagaaaacaccatagaagggatagtaaatcataccattgatcttttaatggatgcggat
ctttttatagtaggagaaatcataatacccataaatctatttctgttatcgttagaaaga
gatattgctaaaataagcaaagtatattcccacaaacatgcgctagcgcaaagcaggaaa
tttttagaaaagcatcttccttttgcagaaatattagaagccaaaagcactgcaaacgcc
tgtgaaatagctcaaaaagaaccaggaacggcagctatagcatctgaagtagcagcttac
gtttacggattaaacatattggcaaaaaacatccaagaccaaaaaaataacttcacaaga
tttttaataataggtaaaacacttacaaagcccacaggaaaagataaaaccagcatcatt
atgggtgttaaaaaccaaacaggagccctttataaagcccttgaaatattttataggcac
aatataaaccttactaaaatagagtcaaggccttccaagaaaaaggcttgggatgatata
ttttatgtagatatggaaggacatatcgaagataaaaatgtaaaagaagcattagaagaa
cttgacaaaaacagccatatgataaaatttttgggctcttatccaagatga

DBGET integrated database retrieval system