KEGG   Helicobacter pylori Shi112: HPSH112_05495Help
Entry
HPSH112_05495     CDS       T02037                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00010  Glycolysis / Gluconeogenesis
hhp00020  Citrate cycle (TCA cycle)
hhp00620  Pyruvate metabolism
hhp00640  Propanoate metabolism
hhp00650  Butanoate metabolism
hhp00680  Methane metabolism
hhp01100  Metabolic pathways
hhp01110  Biosynthesis of secondary metabolites
hhp01120  Microbial metabolism in diverse environments
hhp01130  Biosynthesis of antibiotics
hhp01200  Carbon metabolism
Module
hhp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH112_05495 (porA)
   00020 Citrate cycle (TCA cycle)
    HPSH112_05495 (porA)
   00620 Pyruvate metabolism
    HPSH112_05495 (porA)
   00640 Propanoate metabolism
    HPSH112_05495 (porA)
   00650 Butanoate metabolism
    HPSH112_05495 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    HPSH112_05495 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH112_05495 (porA)
Enzymes [BR:hhp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH112_05495 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFI01292
LinkDB All DBs
Position
1133931..1135154
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTRTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIVHLCEIFEEINEDALKGTLTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaattacaagagatagaggtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattacggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagctgcagcagctggtgga
agagtcagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttgagtagggattctggctggataagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcccactattgtcaatcaagatggctttttatgctcgcac
accgtgcaaaatgtccgccccttgagcgatgcagtggcttaccaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataagccggtaagctatggcgcacaagctgaa
gaagaatggcattatgaacataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgact
agaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggcgacc
atccattccttacgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gctttagcgattttagacaagagctctccagcgggtgctatgggagcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactatatc
tatggtttaggcgaaagggatatgacaatcgtgcatttatgcgaaatttttgaagaaatc
aacgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggtttgcgt
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system