KEGG   Helicobacter pylori Shi169: HPSH169_00960Help
Entry
HPSH169_00960     CDS       T02038                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00061  Fatty acid biosynthesis
hhq00780  Biotin metabolism
hhq01100  Metabolic pathways
hhq01130  Biosynthesis of antibiotics
hhq01212  Fatty acid metabolism
Module
hhq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hhq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPSH169_00960
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HPSH169_00960
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HPSH169_00960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hhq01004]
    HPSH169_00960
Enzymes [BR:hhq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HPSH169_00960
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HPSH169_00960
Lipid biosynthesis proteins [BR:hhq01004]
 Fatty acid synthase
  Component type
   HPSH169_00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR DUF1509
Motif
Other DBs
NCBI-ProteinID: AFH98898
UniProt: A0A0E0WAV6
LinkDB All DBs
Structure
PDB: 

Position
186960..187787
Genome map
AA seq 275 aa AA seqDB search
MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYV
YELDVSKEEHFKSLYDSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISV
YSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHN
IRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSNLSSGVS
GEVHFVDAGYHVMGMGAVEEKDNKATLSWDLHKEQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttaaaaggtaaaaaagggcttattgtaggggtggcaaacaataaatccatc
gcttatgggatcgctcaatcttgtttcaatcaaggggctactttggctttcacttatttg
aatgagagtttagaaaagcgcgtgaggcctatcgcacaggaattgaatagcccctatgtg
tatgaattagatgtgagcaaagaagagcatttcaagtcgctatatgatagcgttaaaaag
gatttaggttcattggattttatcgttcatagcgtggcctttgcccctaaagaggcttta
gaggggagtttgttggaaacttctaaaagcgcgtttaacaccgctatggaaatttctgtt
tattctttaatagagctgacaaacaccctaaaacctttattaaataacggagcgtctgtt
ttgactttaagctatttaggcagcaccaaatacatggcgcattacaatgtgatggggttg
gctaaagcggccctagagagtgcggtgcgttatttagcggtggatttaggcaagcataac
ataagagtgaatgccctatcggctgggcctattaggacgctcgcttctagcgggatcgct
gattttagaatgattttaaaatggaatgaaatcaacgcccctttaagaaaaaatgtgagt
ttagaagaagtgggcaatgccgggatgtatttgctctctaacttgtctagtggggtgagt
ggggaggtgcattttgtggatgctggctatcatgttatgggcatgggggctgtggaagaa
aaagataataaagctacgctatcgtgggatttgcataaagaacaataa

DBGET integrated database retrieval system