KEGG   Helicobacter pylori Shi169: HPSH169_03785Help
Entry
HPSH169_03785     CDS       T02038                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00473  D-Alanine metabolism
hhq00550  Peptidoglycan biosynthesis
hhq01100  Metabolic pathways
hhq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPSH169_03785 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPSH169_03785 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HPSH169_03785 (ddl)
Enzymes [BR:hhq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPSH169_03785 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hhq01011]
 Precursor biosynthesis
  Amino acid ligase
   HPSH169_03785 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_TupA RimK GARS_A VitD-bind_III ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AFH99451
UniProt: A0A0E0WCA5
LinkDB All DBs
Position
779678..780721
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEHEISIVSAIALKEALKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI
KEKKLPPLILTRNGLLKNSFLGTKTIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSCNKYLTKLYAKDLGVKTLDHVLLNEKNRANALNLIGFNFPFIIKPSNAGSSLG
VSVVKEEKELIYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYIEEPNKQEF
LDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFDGALIRCDFFVIENEVYLSE
INPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggaattttgcgttttatttggtggggcgagttttgagcatgaaatcagcattgtgagc
gcgatcgcgcttaaagaagcgctaaaggataggattaaatattttatttttttagatgaa
aaccatcatttttatttgattgaagaatctaacatgcattcaaaatacttcgctcagatc
aaagaaaaaaaattaccccctctaatccttacgcgcaatggtttgcttaaaaactcgttt
ttaggcactaaaacgatagaattgcctttagtgatcaatcttgtgcatgggggcgatggc
gaagacgggaaattagcgagcttgttagaattttatcgtatcgcttttataggccctagg
attgaagcgagcgtgttgagttgtaacaaatatttaaccaagctttacgccaaagactta
ggggtaaagactttagatcatgttcttttgaatgaaaaaaaccgtgctaacgctctaaat
ttgattggctttaattttcctttcataatcaagcctagcaatgccgggagctctttaggg
gtgagcgttgtgaaagaagaaaaagaattgatttacgctttagacggtgcgtttgaatat
tctaaagaagtcttaatagagcctttcattcagggagtgaaagaatacaatttagccggt
tgtaagatcaaaaaggatttctgtttttcttatattgaagagcctaacaaacaggaattt
ttagacttcaaacaaaaatatttggatttttcacgcaataaagcccctaaagcgaatctt
tctaacgccctagaagaacaattgaaagaaaattttaaaaaactctataacgatttgttt
gatggcgcgctcatccgttgcgatttttttgtcatagaaaatgaagtgtatcttagtgag
atcaaccccattcctggcagtttggccaattatttgtttgatgattttaaaacaacgcta
gaaaatttagcgcaatcattacccaaaacccctaaaatccaaatcaaaaactcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system