KEGG   Helicobacter pylori Shi169: HPSH169_05995Help
Entry
HPSH169_05995     CDS       T02038                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hhq  Helicobacter pylori Shi169
Brite
KEGG Orthology (KO) [BR:hhq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hhq03012]
    HPSH169_05995
   03029 Mitochondrial biogenesis [BR:hhq03029]
    HPSH169_05995
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhq04147]
    HPSH169_05995
Translation factors [BR:hhq03012]
 Eukaryotic Type
  Elongation factors
   HPSH169_05995
 Prokaryotic Type
   HPSH169_05995
Mitochondrial biogenesis [BR:hhq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HPSH169_05995
Exosome [BR:hhq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HPSH169_05995
  Exosomal proteins of breast cancer cells
   HPSH169_05995
  Exosomal proteins of colorectal cancer cells
   HPSH169_05995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFH99861
UniProt: A0A0E0WDG9
LinkDB All DBs
Position
complement(1240286..1241485)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIVAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRATQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaatagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcggtgctttctttgaagggt
cttgcagaaatgaaagactatgataatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgcccaggacacgccgactatgtaaaaaacatgatcaccggtgcggcgcaaatggat
ggagcgattttggttgtttctgcagctgatggccctatgcctcaaactagggagcatatc
ttattgtctcgtcaagtaggtgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagagttggtagaaatggaagtgcgcgaattgttgagcgcg
tatgaatttcctggcgatgacactcctatcgtagcgggttcagctttaagagctttagaa
gaagcaaaggctggcaatgtgggtgaatggggtgaaaaagtgctgaagctcatggctgaa
gtggatgcttatatccctactccagaaagggatactgaaaaaactttcttgatgccggtt
gaagatgtgttctctattgcgggtagaggaactgtggttacaggtaggattgaaagaggc
gtggtgaaagtgggcgatgaagtggaaatcgttggtatcagagctacacaaaaaacgact
gtaaccggtgtggaaatgtttagaaaagagttagaaaaaggtgaggccggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtagaacgcggtatggttctatgcaaa
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgtcctctccaaagaa
gaaggtgggagacacactccattcttcaccaactaccgtccgcaattctatgtgcgcacg
actgatgtgactggctctatcacccttcctgaaggcgtggaaatggttatgcctggcgat
aatgttaaaatcactgtggagttgattagccctgttgcattggaattgggaactaaattt
gcgattcgtgaaggcggtaggaccgttggtgctggtgttgtgagcaatattattgaataa

DBGET integrated database retrieval system