KEGG   Helicobacter pylori Shi417: HPSH417_04585Help
Entry
HPSH417_04585     CDS       T02039                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hhr  Helicobacter pylori Shi417
Pathway
hhr00473  D-Alanine metabolism
hhr01100  Metabolic pathways
hhr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hhr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPSH417_04585
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HPSH417_04585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hhr01011]
    HPSH417_04585
Enzymes [BR:hhr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HPSH417_04585
Peptidoglycan biosynthesis and degradation proteins [BR:hhr01011]
 Precursor biosynthesis
  Racemase
   HPSH417_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFH98052
LinkDB All DBs
Position
complement(942996..944129)
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNTASLRHNFSAVKSIVPKDAHIMAVVKANAYGVGAIKASEIFLQEGANYL
GVATLDEALELRSYFSKTPILILGYSPNSNASMLIDNDLSAMIFSLEQAEVFSQTALKSQ
KRLKVHLKIDTGMHRLGLEPNFKSIEIIKKIRALKGLEMEGIFTHLSNADAKIKTHAKNQ
MKAFNAFLEQLLNQKIEFQYRHAYNSAGILSLCNGNENRFLNLYRPGIMLYGFYPSNGMK
ETCPTILKNVISLKAQIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLMRALGN
RIQVAINNQLAPLIGKVCMDQCFVKLNNIQAKEGDEVILFGDKSAKANDASEIAALLNTI
PYETISTLSKRLERVYI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtgaataccgcttctttaaggcataattttagc
gcagtcaaaagcattgtccctaaagacgcccacatcatggcggttgtcaaggcgaacgct
tatggggtgggagccataaaagcgagcgaaattttcttacaagaaggggctaattatcta
ggagtagcgactttagatgaagctttagagttgcgctcttatttttctaaaacccccatt
ttgattttaggctatagccctaattctaacgcttccatgctgattgataacgatttgagc
gctatgatttttagccttgaacaagcggaagttttttctcaaacggctttaaagtctcaa
aaacgcttaaaagtgcatctcaaaattgataccggcatgcaccgcttgggattagaacct
aattttaaaagcatagaaatcattaaaaaaatccgcgctttaaaaggcttggagatggag
gggatattcacgcatttaagcaacgctgacgctaagattaaaacccatgctaaaaaccaa
atgaaagcctttaacgcttttttagaacagcttttaaatcaaaaaatagagtttcaatac
cgccatgcttacaattccgccggtatcctttctttgtgtaacgggaatgaaaatcgcttc
ttaaacctctatcgcccaggaatcatgctctatggtttttacccttctaatggaatgaaa
gaaacatgcccaaccattttaaaaaatgttatcagtttaaaagctcaaatcgttcaaatc
agaagcgttaaaaaaggcgaatttattggctatggcgagcatttttacacgaatgaagaa
actttagtgggtgttttagctctagggtatgcggacgggttaatgcgcgctttaggcaat
cgcattcaagtagcgatcaataaccaattagccccccttattggcaaggtgtgcatggat
caatgctttgtcaagctcaataatattcaagccaaagagggcgatgaggtcatcttgttt
ggggataaaagcgctaaggctaacgatgcaagcgaaatcgctgcacttttaaacaccatt
ccttatgaaaccatcagcaccctatccaaacgcttggaacgcgtctatatttaa

DBGET integrated database retrieval system