KEGG   Candidatus Pantoea carbekii: HHS_02090
Entry
HHS_02090         CDS       T02865                                 

Gene name
prlC
Definition
(GenBank) PrlC protein
  KO
K01414  oligopeptidase A [EC:3.4.24.70]
Organism
hhs  Candidatus Pantoea carbekii
Brite
KEGG Orthology (KO) [BR:hhs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hhs01002]
    HHS_02090 (prlC)
Enzymes [BR:hhs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.70  oligopeptidase A
     HHS_02090 (prlC)
Peptidases and inhibitors [BR:hhs01002]
 Metallo peptidases
  Family M3
   HHS_02090 (prlC)
SSDB
Motif
Pfam: Peptidase_M3 CREPT DUF1512
Other DBs
NCBI-ProteinID: BAO00179
UniProt: U3U7G0
LinkDB
Position
complement(308698..310734)
AA seq 678 aa
MTNPLLAPFTLPPFSQIEPKHIVPAIKEILRNCRKKVEEVIKAGRPYSWNNLVQPLDDIH
DYLNRIFSIINHLNSTKNSLELRKAYEQALPLLSEYNTWLGQNKDLYRAYWNLKQSDVYT
MFNLAQKKSIDNKLRDFELSGVKLNNVQQKRYAEISTSLANLSSLYSNNLLDSTMAWSKL
ITNKAELVGIPENILAKTKKQAEAKGQNGWLLTLDHPSYVGVMNYCDNAHLRKEMYFAYS
TRASDKGPYARKWDNTPIMVEQLILRHELAKLLGFNCYADKSLITKMAQHSCKVMTFLTG
LVKRVRPQAEKEFDQLHKFVKKNFGIDKVQPWDFDYFSEKQKHSFYNISDEQLRPYFPEV
FVLKGLFEIVKRIYSILIKERIDIDLYHAEVRFFDIFDDSDNLLGSFYLDLYARENKRGG
AWMDTCINRMRKGDGSLQKPVAYITCNFNGPVYDKPALFTHNEVITLFHEFGHGLHHILS
RIEVLGVSGLDGIPWDAIELPSQLMENWCWEPEAIRLISGHYETGESLPSTLLNKILLLK
NYQAALFILRQLEFSIFDFRLHIECNPKTGVQILETLWEVKKQVSVIPNLEWTRFPHSFS
HIFSGGYAAGYYSYLWANVLSSDVYSRFLEEGIFNHQTGQSFLDKILTCGGVEEPIVLFK
RFRGREPNPEEMLKYYGL
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgacaaatccattacttgcaccttttacattaccacctttctcccaaatcgaaccaaaa
catattgtgcctgctattaaagaaatactgagaaattgtcgtaaaaaggtagaagaagtt
ataaaagcaggcaggccgtattcgtggaataacttagtacagcctttagatgacattcat
gattatcttaaccgtattttttcaataattaatcatctaaattcaacaaaaaatagttta
gaacttcgtaaagcttatgaacaggcattacctttactttcagaatacaacacttggtta
ggtcaaaataaagatttataccgagcatactggaatttgaaacagagcgatgtttataca
atgtttaatcttgctcaaaagaaatcaatagataataagttacgtgattttgagctatca
ggcgttaaattgaataatgtacaacaaaaacgttatgcagaaatttctacaagtttagct
aatttaagttcactgtatagtaataatttactcgattctactatggcatggagtaaatta
ataacaaacaaagcagagttagtaggcataccagaaaatatattagcgaaaacaaaaaaa
caagcagaagcaaaaggacaaaatggatggttattaactttagatcatccaagttatgta
ggagttatgaactattgtgataatgcccatttacgaaaagagatgtactttgcttattca
acacgtgcttccgataaagggccgtacgctaggaaatgggataatactccaattatggtt
gagcaattaatattacgtcatgaattagcaaaactacttggtttcaattgctatgcagat
aaatcactaataaccaaaatggcacagcactcctgcaaggtgatgacgtttttaaccggt
cttgtaaaacgtgtacgaccgcaagctgaaaaagaatttgatcaattacataaattcgtt
aaaaaaaactttggaattgataaagtacaaccttgggattttgattatttttctgaaaaa
caaaaacattctttttataatattagcgacgaacagcttcgtccctattttccagaagta
tttgtacttaaaggtttatttgaaatagtaaaacgcatctacagtattttaattaaggaa
cgtattgatatcgatttatatcatgcagaagtacgttttttcgatatttttgatgacagt
gataatttgctaggcagtttttatcttgatctatatgcacgtgaaaataaacgcggtggt
gcttggatggacacttgtattaatcggatgcgtaagggtgatggaagtttacagaaacct
gttgcttatatcacctgtaatttcaatggtccagtgtatgacaaaccagcgttatttaca
cataatgaggtaattacattatttcatgaatttggtcacggcttacatcatatactctca
cgtattgaagtattaggagtatctggtcttgatggtattccatgggatgctatcgaatta
cctagtcaattaatggaaaattggtgttgggagccagaagcaataagattgatatctgga
cactatgaaactggcgaatcactaccttcaacattactaaataaaatactcttattaaag
aactatcaggccgcgttatttatattacgtcagctagaatttagtatatttgatttccgt
ttgcatattgaatgtaatcctaaaacaggagttcaaattcttgaaacactatgggaagta
aaaaaacaagtttccgtaattccaaatttagaatggacccgcttcccacattcttttagc
catattttttctggcggttacgctgctggttattatagttatttatgggctaatgtctta
tcttccgatgtttattcgcgttttttagaagaaggaatttttaaccaccaaactggacag
tcatttctcgacaagattttgacatgtggcggtgttgaagaaccgatagtgttatttaag
cgttttcgtggtcgcgaacctaatcctgaagagatgttaaaatattacggtctttaa

DBGET integrated database retrieval system