KEGG   Candidatus Pantoea carbekii: HHS_07530Help
Entry
HHS_07530         CDS       T02865                                 

Gene name
sdhB
Definition
(GenBank) SdhB protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
hhs  Candidatus Pantoea carbekii
Pathway
hhs00020  Citrate cycle (TCA cycle)
hhs00190  Oxidative phosphorylation
hhs00650  Butanoate metabolism
hhs01100  Metabolic pathways
hhs01110  Biosynthesis of secondary metabolites
hhs01120  Microbial metabolism in diverse environments
hhs01130  Biosynthesis of antibiotics
hhs01200  Carbon metabolism
Module
hhs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hhs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hhs_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HHS_07530 (sdhB)
   00650 Butanoate metabolism
    HHS_07530 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HHS_07530 (sdhB)
Enzymes [BR:hhs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HHS_07530 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     HHS_07530 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: BAO00723
UniProt: U3U9T4
LinkDB All DBs
Position
complement(1050636..1051355)
Genome map
AA seq 239 aa AA seqDB search
MELQLSIYRYNPSFDDKPYMQDFILKVDDDGKMMLLEVLIRLKEKDPTLTFRRSCREGVC
GSDGLNINGKNGLACITPICSIKNSQRKIVVRPLPGLPVIRDLVVDMEKFYIQYQKIKPF
LLNNSENVPVREYIQNLDERKQLDGLYECVLCACCSTACPSFWWNPDKFIGPAGLLTAYR
FLIDSRDTETQTRLANLKDAFSVFRCHSIMNCVNVCPKGLNPAQAIGKIKSLLVRQEVC
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcaattatctatttatcgttataacccgagttttgatgacaaaccatatatg
caggatttcattttaaaagtagacgatgatggtaaaatgatgttattagaagtattgatt
cgtttaaaagaaaaggatccaacattaacttttcgtcgttcttgtcgagaaggtgtatgt
ggttcggatggtctaaatataaatggaaaaaacggtttagcatgtattactccaatttgt
tcaataaaaaatagtcagcgtaaaattgtggtacgtcccttaccaggactgccagttatt
cgagatcttgtagttgatatggaaaaattttatattcaatatcaaaagattaaacctttc
ctattgaataattctgaaaatgtacctgtacgagaatatatacagaatcttgatgaacgt
aaacagttagatggcctttacgaatgtgttctgtgtgcatgttgttctactgcctgcccg
tctttttggtggaatccagataaattcattggtccagctggcttgttaactgcatatcga
tttctaatcgatagccgcgatacagaaactcaaacacgtttggctaatctcaaagatgct
ttcagtgtatttcgttgccatagtattatgaattgcgtaaatgtatgtcctaaaggactt
aatccagcacaagctattggaaaaattaaatcgctccttgtacgacaggaagtatgttaa

DBGET integrated database retrieval system