KEGG   Haloarchaeon HSR6: HSR6_0704Help
Entry
HSR6_0704         CDS       T04550                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hhsr  Haloarchaeon HSR6
Pathway
hhsr00240  Pyrimidine metabolism
hhsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhsr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HSR6_0704 (tdk)
Enzymes [BR:hhsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HSR6_0704 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: APE95163
UniProt: A0A1J1ABK2
LinkDB All DBs
Position
665010..665597
Genome map
AA seq 195 aa AA seqDB search
MRAIRENGWVEVISGSMFSGKTEELLRRLRRAEIAGQEVVAFTPAVDDRYGQAELGSHAG
HTWEATVVDNTAEGVRSIPDRADGASVVAIDEANFFPEELVAVANELATAGRRVIVSGTD
QTYRGEPFEPLGQLMATAEYVDKLRAICAVCGEPATRNQRLVDGEPAHVDEPTIVVGAEE
SYEARCRSCHEVRTD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgatcagggaaaacgggtgggtcgaggtcatttccggctcgatgttctcgggg
aagaccgaggaactcctgcgacgactccgccgtgcggagatcgccggccaggaggtcgtg
gcgttcacgccggcggtggacgaccgctacgggcaggccgaactcgggtcccacgccgga
cacacctgggaggcgactgtcgtggacaacacggccgagggggtgcgctcgattcccgac
cgggccgacggcgcctcggtcgtcgccatcgacgaggcgaacttcttccccgaggaactg
gtcgccgtcgcaaacgagctagcgaccgccggtcgccgcgtgatcgtcagcgggaccgac
cagacctaccgaggcgaacccttcgagccgctggggcaactcatggcgaccgccgagtac
gtcgacaaactccgggcgatctgtgcggtctgtggcgagccggccacccgcaatcagcgc
ctggtcgacggcgaacccgcacacgtcgacgagccgacgatcgtggtcggtgccgaagag
tcctatgaggcgcggtgtcgaagctgccacgaggtccgaacggactga

DBGET integrated database retrieval system