KEGG   Haloarchaeon HSR6: HSR6_0869Help
Entry
HSR6_0869         CDS       T04550                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hhsr  Haloarchaeon HSR6
Pathway
hhsr00564  Glycerophospholipid metabolism
hhsr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HSR6_0869 (glpA)
Enzymes [BR:hhsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HSR6_0869 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Fer2_BFD Pyr_redox_2 GIDA HI0933_like FAD_oxidored Pyr_redox_3 Pyr_redox Amino_oxidase FAD_binding_3 NAD_binding_8 3HCDH_N DAO_C NAD_binding_7 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APE95322
UniProt: A0A1J1AB10
LinkDB All DBs
Position
811800..814655
Genome map
AA seq 951 aa AA seqDB search
MGQRVVVVGGGVTGVGVARDLAMRGADVTLLERDRLAAGTSGRMHGLLHSGARYALSDPA
AAEECLHENAILREIASHCIEDTGGLFVSLPADDPDYYDSKLAACEEIGIPTEELTPTAA
QKLEPALSNDLDRAFRVPDGAIDPFRLIVANAKSAANHGAKIETDTPVTGLLVEDGQVVG
VRTGDERTIRANHVVNAAGPWAGQLFADLAVDVPLAPAQGAMAVTNARPVETVINRCRPT
DEGDILVPHETTAILGTTDRAIDGPDAISETGEEIELLREELAKLVPELADTRLIRTYWG
VRPLYDPDDGGESGRDFAVLDHGERDDLPGVTTVVGGKLTTYRLMAEAVSDAVAEKLGLD
APCRTAEEPLPGSGDRPGWEAVASRYDLRNPVAHRTATRLGDRTEPVLDDAQPNPVVCEC
EGVTDAEIRDAIRDVGADLDGVRSRTRATMGPCQGGVCAHRIAGVLAEAVGSDPAWSELS
SLVAERDRGQRHLDSPAQRAQIERNRLRRGRLLNLAAGKASDGLPLGDFATGTASAAGHS
SKEYGQSSPTTGPQDVIVYGGGLAARLAALAAAQEGVSVALLTPDSLTPDGFTGMVDLLG
SLPGDTGLVADPIPAVDSLPDSHPLRRAGAAGVREALDRFDAVVGSTLAGSATERNGLVS
SPVGTPLPVARYPPSFEPGLLSRRSDTLLVGFESIPDFPAKFAAETLSNRVPYAVRGATI
ELCATAPERPVRRLARALDRNERWPSDEPIRSTLAQVLDRVHEGESRIGLPSMLGIEATF
EIRSELSTQLGAEVFELPVPAPSAAAIRLSDRLDAQLRAHGVEVRQRVEDLALAGQARIE
AVDVQNGPRYEASQVVLATGGVAAGGLTMDRSGVQEPTFGLPVEHQTDHQAGLAVDPDWR
PGANGVICHPNLRAAGSILGGFDPATEHSRAGVEIVTGVQAGLAAAREVTR
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgggacaacgggtcgtggtcgtcggcggcggggtcaccggggttggcgtcgctcgcgac
ctggcgatgcgtggcgcggacgtaactcttctggagcgggatcgactggcggccggcacc
tcgggtcggatgcacgggctgctccacagcggggctcgctacgcgctctccgatccggct
gccgccgaggagtgtctccacgagaacgccatcctccgagagattgcgagtcactgcatc
gaggacactggcggcctcttcgtctcgctccccgcggacgaccccgactattacgactcg
aagctggccgcctgcgaggagattgggatcccgaccgaggaactgacacccacggcggct
caaaaactcgagcccgcactgagtaacgacctcgaccgtgcctttcgcgttccggacggc
gcgatcgatcccttccggctgatcgtcgcgaacgcgaagagcgcggcgaatcacggtgcg
aaaatcgagaccgacaccccggtcaccggattgctggtcgaagacggccaggttgttggg
gtgcgaaccggggatgagcgcaccattcgggccaaccacgtcgtcaacgctgctggcccc
tgggcggggcaactcttcgccgacctcgcggtcgacgttccgctcgcgccggcccagggg
gcgatggcggtgacgaacgctcgcccagtcgagacggtgatcaaccgctgccgacccacc
gacgagggcgatatcctcgtcccccacgagacgacggcgattctgggcaccaccgacaga
gcgatcgacgggccggatgcgatcagcgagacgggtgaggagatcgaactgcttcgcgag
gaactggcaaagctggtgccggaactggcagacacgcgactcatccggacctactggggc
gtgcgcccgctctacgatcccgacgacgggggtgagtcggggcgggatttcgcggtcctc
gatcacggcgagcgggacgacttgcccggagtgacgacggtggtcgggggcaagctgacc
acctatcgactgatggccgaggccgtctcggacgcggtcgcggagaagttgggcctcgac
gccccctgccgaacggccgaggaacccttgccaggcagtggcgaccggcctggctgggaa
gccgtcgcctcgcggtacgacctccgcaatccagtcgcccaccggaccgcaacccggttg
ggggaccgcacggagccagttctcgacgatgcccagcccaatcccgtcgtctgtgagtgt
gaaggcgtcacggacgccgagatccgtgacgcgattcgggacgtgggtgccgacctcgac
ggcgtgcgctcgcgcacccgggcgaccatggggccctgccagggcggggtctgtgcccat
cgaatcgccggcgtgctcgccgaggcggtcggatcggacccggcttggtcggaactctcc
tcgttggtggccgaacgcgaccggggccagcgccatctcgattctcccgcccagcgggcc
cagatcgagcgcaaccgactccgacgcggccggctcctgaacctggcggcaggaaaggcc
agcgacgggctccctctcggggacttcgcgacggggacggcgtcggccgcaggccactcc
tccaaggagtacggccagtccagccccacgactggcccgcaggacgtgatcgtctacggt
ggcgggctcgcggcgcggctggccgcgctcgcggctgcccaggaaggggtgtcggtcgcg
ttgctgactcccgactcgctcacgccggatgggttcactggaatggtggacctcctgggc
tcgcttcccggggataccggattggtggccgaccccatccccgccgtcgactcgctcccc
gattctcatccgttgcggagggcaggcgctgcgggggttcgcgaggcgctcgaccgcttc
gacgcggtggtgggatcgaccctcgctgggagcgccacggagcggaacggcctggtttcc
tccccagtcggaacgccgctacctgtggcccgctatccgccgagtttcgagcccggactg
ttgtccaggcgatcggataccctgctcgtcggcttcgaatcgattcccgatttcccggcg
aaattcgcggccgagacgctctcgaatcgcgtcccgtacgcggtccggggggccactatc
gaactctgcgcgacggcacccgagcggcctgtcagacgactcgcccgggccctggaccgg
aatgaacgctggccgagtgacgagccgattcgctcgaccctggcacaggtactcgaccgg
gtccacgagggcgagagccgaattggactgccgtcgatgctcgggatcgaggcaaccttc
gaaattcggagcgaactctccacacagctcggggccgaggtcttcgagctcccggtcccg
gcccccagcgcggccgcgatcagactgagcgaccggctcgacgcgcaactgcgcgcacac
ggggtcgaggtcagacaacgcgtcgaggacctggccctcgcgggccaggcccggatcgag
gccgtcgacgtgcaaaatggtccccgatacgaagccagccaggtcgtcctcgcgaccggt
ggggtggccgccggggggctgaccatggaccgatcgggcgtccaggaacccacgtttggc
ctgccagtcgagcaccagaccgaccaccaggcgggactggcggtcgatccggactggcgg
cccggagcaaacggcgtgatctgccatcccaacctccgggccgcgggctcgattctgggt
ggtttcgacccggccaccgagcactcccgggccggcgtcgaaatcgtcaccggcgtgcag
gccgggctggccgcggcccgggaggtgacgcgatga

DBGET integrated database retrieval system