KEGG   Haloarchaeon HSR6: HSR6_1334Help
Entry
HSR6_1334         CDS       T04550                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hhsr  Haloarchaeon HSR6
Pathway
hhsr00620  Pyruvate metabolism
hhsr00680  Methane metabolism
hhsr00720  Carbon fixation pathways in prokaryotes
hhsr01100  Metabolic pathways
hhsr01120  Microbial metabolism in diverse environments
hhsr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HSR6_1334 (ppc)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HSR6_1334 (ppc)
   00680 Methane metabolism
    HSR6_1334 (ppc)
Enzymes [BR:hhsr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HSR6_1334 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APE95777
UniProt: A0A1J1ADX0
LinkDB All DBs
Position
1280728..1283424
Genome map
AA seq 898 aa AA seqDB search
MDLHNRSVRQDVRELGALLGDVVSDHSPPESFELVESARNEAIAYRRGRTDDREPLTSVV
GSNSEAVNAVLARSFTIYFQLINLAEERERVRALRTFRQQGTISHSITEAMENLAEAGAD
AETVGQVLSDVHVVPTFTAHPTEARRKTVKGILQRVGRILEDLDERRLTNEEETALTARL
NAVVESLYTTKHIRDRRPEPFDEARNVQWYLDNVIFDVIPEIYAELEAALEENFEDPPDP
AHVLEFRSWAGSDADGNPNVTPEVTDKTLHRQRSLALARYREALEDLLGVLSQDGTRVDV
ETYLDTIMTGESTTESIAETAAERYPREPFRQATTVILERVDRVESVRPGGYEDGEALLE
DLSALAEALSAEGLDSIVSEFVTPLKRQVQTFGFHLASLDLRDHRQQHTQALSEALGAED
IDYAGMDESERQEFLTEAITRSAPVLDLEDRTEFTDETAVVLERFDRLADWHEEFGPDSI
DAYCISMTEEPSHVLEVLFLADQAGVVDYPDYSGLDVVPLLETESALSNARDIIGTLFEN
EAYGAAMRARDETQEIMLGYSDSNKENGYLAANWQLDRAQRRLAEITDDYGVELRLFHGR
GGTISRGGGPMNDALLALPKQTVTGEVKFTQQGEAISEKYGNARIARREMGQMLNAQIRA
RHANMSEPDPTLPEPWVEAMDEMADTARETYRSLLETEGFVSYFEQTTPIKTIEGLNLGS
RPASRSDERNVEDLRAIPWVFAWTQSRAIIPGWFGIGSGIDAYLAETDDGLERLKAMYES
WPFFQTMLDNAALSLARTEMEIASEYATLADDDLQARIFPAIENEYERSKERVLDIIPRE
DLVDRSWLRESLDRRNPYVDPLNFLQIQLLSRSHRTPQEERTLRLTVKGIAAGMKNTG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggaccttcacaaccggagcgtccgacaggacgtccgcgaactcggggcgctcctcgga
gatgtcgtatccgaccacagcccaccggagagtttcgaactcgtggagtcggcacgtaac
gaagcgattgcctaccggcgtggccgaaccgacgaccgcgaaccactgacttccgtcgtt
ggctccaattccgaggccgtaaacgccgttctcgcgcgctctttcacgatttacttccag
ttgatcaacctcgcggaggaacgggagcgcgtccgcgcgctgcgcaccttccgtcagcag
ggaacgatctcccactcgatcacggaggcgatggagaacctcgctgaggcaggggcggac
gccgaaacggtcggccaggtcctctcggacgttcacgtggtcccgaccttcaccgcccac
ccgacggaggcccgacggaagaccgtcaagggcatcctccagcgggtggggcggattctc
gaggatctcgacgagcgccggttgaccaacgaagaggagaccgcgctcaccgcgcgcctg
aacgcggtcgtcgagagtctctacaccacgaaacacattcgcgaccggcggccggagcca
ttcgacgaggcccggaacgtccagtggtacctcgacaacgtgatcttcgacgtgattccg
gagatctacgccgaactggaagcggccctggaggagaacttcgaggaccctcccgatccg
gcccacgtccttgaattccggtcctgggctggcagcgacgccgacggaaatcccaatgtc
acccccgaggtcaccgacaagaccctccaccgtcagcgctcgctcgcactcgcccgctac
cgggaggctctggaggacctgctcggtgtgctgagccaggacgggacccgggtggacgtc
gagacgtacctcgatacgatcatgaccggggagtcgacgaccgaatccatcgccgagacg
gccgccgaacgctacccccgagagccgttccggcaggcgacgacggtcatcctggagcgt
gtcgaccgcgtcgagagtgtccgtcctggcgggtacgaggacggcgaggcactcctcgag
gacctctccgcgcttgccgaggctctgtcggccgaggggctggactcgatcgtttcggag
ttcgtcacgccgctgaaacgccaggtccagacgtttggcttccacctcgcctcgcttgac
ttgcgcgatcaccgccaacagcacacccaggcactttcggaagcactgggagccgaagac
atcgattacgccgggatggacgaatccgagcgccaggagttcctgaccgaggcgattacg
cggtcggcccccgtcctcgacctggaagaccggaccgagttcacggacgaaacggcagtg
gtcctcgaacggttcgaccgcctggccgactggcacgaggagttcggccccgacagtatc
gacgcgtactgcatcagcatgaccgaggagcccagccacgttctggaggtgctcttcctg
gctgatcaggccggtgtcgtcgattatcccgattattcgggtctggatgtcgtcccgctt
ctggagaccgaatcggcgctctcgaacgcccgggacatcatcggcacgctgttcgagaac
gaagcctacggcgcggcgatgcgggccagagacgagactcaggagatcatgctggggtac
tccgactcgaacaaggaaaacgggtacctggccgccaactggcaactcgaccgggcccag
cgtcggctggccgagatcaccgacgactacggcgtcgagttgcgcctcttccacggccgt
ggcggcaccatctcccgtggcgggggcccgatgaacgacgcgctgttggccctgcccaag
cagacggtcacgggcgaagtgaagttcacacaacagggcgaggccatctcggagaagtac
ggcaacgcgcggatcgcccgtcgggagatgggccagatgctcaacgcccagatccgcgcc
cgccatgccaacatgagcgagccggacccgacgcttcccgagccctgggtcgaggcgatg
gacgagatggccgacacggcacgtgagacctaccgctcgctcctggagaccgagggcttt
gtcagttacttcgagcagacgaccccgatcaagacgatcgaaggactcaacctgggttcc
cggcccgcctcacgcagcgacgagcggaacgtcgaggacctccgggccatcccatgggtg
ttcgcctggacccagtccagggccatcatcccgggctggttcggaatcggctcggggatc
gacgcctacctggcagagaccgacgacggcctcgaacggctcaaggcgatgtacgagtcc
tggccgttcttccagacgatgctcgacaatgcggccctctcgctggcccgcacggaaatg
gaaatcgcaagcgagtacgccaccctcgcggacgacgatctccaggcccggatcttcccg
gccatcgagaacgagtacgagcgatccaaagagcgagtgcttgacatcattccccgcgag
gatttggtcgaccgaagctggctccgcgagagtctggatcgacggaacccctacgtggat
ccgctgaacttcctccagatccagttgctctcccggtcacatcgcacgccccaggaggag
cgaaccctgcggctgacggtgaaagggatcgcggccggcatgaaaaacaccggataa

DBGET integrated database retrieval system