KEGG   Herbaspirillum hiltneri: F506_00535Help
Entry
F506_00535        CDS       T04039                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hht  Herbaspirillum hiltneri
Pathway
hht00473  D-Alanine metabolism
hht00550  Peptidoglycan biosynthesis
hht01100  Metabolic pathways
hht01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    F506_00535
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F506_00535
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    F506_00535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hht01011]
    F506_00535
Enzymes [BR:hht01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     F506_00535
Peptidoglycan biosynthesis and degradation proteins [BR:hht01011]
 Precursor biosynthesis
  Amino acid ligase
   F506_00535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp CPSase_L_D2 TTL ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: AKZ61349
UniProt: A0A0K2B7S5
LinkDB All DBs
Position
127121..128164
Genome map
AA seq 347 aa AA seqDB search
MMNQINQAAGFGKVGVLFGGRSAEREVSLMSGAGVLKALRSKGVDAHPFDPAERSLAELA
AEKFDRVFIALHGRYGEDGTLQGALEQLGIPYTGPGVMASSIAMDKVMTKRIWLGYDLPT
PRFVVLDSAATPREELRQVPDVLGLPLMLKAPHEGSTIGIAKVAGYSDMQEGFDLCAQYD
AVVLAEEFVTGRELTVPVMGKGTSGDNKAKAFPVIEIRAPEGNYDYQHKYFTDDTKYLCP
APLDEALTQRVQELAVKAYNALGCRGWSRVDFMLRASDNEPFLLEINTSPGMTGHSLVPM
SARQAGMTYEDLCYEILKFAALDLKPSDAWKSPAAANAGDADVSDKG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccagatcaatcaagctgccggattcggcaaagtcggcgtgctgttcggcggc
cgttccgccgagcgcgaagtgtcgctgatgtccggcgcgggcgtactcaaggcgctgcgc
agcaagggcgtcgacgcgcatcccttcgatccggccgagcgcagcctggcggaactggcg
gccgagaaattcgaccgcgtgttcatcgcgctgcacggccgttacggcgaagacggcacg
ctgcaaggcgcgctggagcaactcggcattccttacaccggccccggcgtgatggcgtct
tcgattgccatggacaaggtcatgaccaagcgcatctggctgggttacgacttgccgacg
ccgcgcttcgtggtgctcgacagcgccgcgacgccgcgtgaagaattgcgccaggtgccc
gacgtgctgggtctgccgctgatgctgaaggcgccgcacgaaggttcgaccatcggcatc
gccaaggtggcgggttattccgacatgcaggaaggtttcgacctgtgcgcgcaatacgac
gcggtggtgctggccgaagaattcgtcaccggccgtgaactgaccgtgccggtgatgggc
aagggcacgagcggggacaacaaggcgaaagccttcccggtcatcgagatccgcgcgccg
gaaggcaactacgactatcagcacaagtatttcaccgacgacaccaagtacctgtgtccg
gcgccgctcgacgaagcgctgacgcagcgcgtacaggaactcgcggtgaaggcctacaac
gcgctcggctgccgcggctggtcgcgcgtcgacttcatgctgcgcgcctcggacaacgag
ccgttcctgctggagatcaacacctcgccaggcatgaccggacactcgctggtgccgatg
tcggcccgccaggcaggaatgacttacgaagacctgtgctacgagattctgaaattcgcg
gcactcgacctgaagccgtccgatgcgtggaaatcacccgcagcggcgaatgccggtgat
gccgacgtttcggataaaggataa

DBGET integrated database retrieval system