KEGG   Herbaspirillum hiltneri: F506_02865Help
Entry
F506_02865        CDS       T04039                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hht  Herbaspirillum hiltneri
Brite
KEGG Orthology (KO) [BR:hht00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F506_02865
Enzymes [BR:hht01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     F506_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin FAD_binding_3 DAO NAD_binding_8 Thi4 AlaDh_PNT_C K_oxygenase Thioredoxin_4 FMO-like Nif11
Motif
Other DBs
NCBI-ProteinID: AKZ65114
LinkDB All DBs
Position
646766..648361
Genome map
AA seq 531 aa AA seqDB search
MLDANLKAQLKAYLEKVTQPIEIVASLDDGAKSRELQELLQEIVTLSERITLVERNDHAA
RKPSFSLNRPGTDISVQFAGIPMGHEFTSLVLALLQVGGHPIKLDDKVIEQIRNLDGDYA
FETYISLTCQNCPEVVQALNVMSIINPRIRAVTVDGALFQDEVEKRQIMAVPTVYMNGEV
FGQGRTGVEEILAKLDTGAAARKGEELSAKEAYDVLIVGGGPAGAAAAIYAARKGIRTGV
VAERFGGQVLDTLAIENFVSVKETEGPQFATALEQHVRAYDVDIMNMQRAEALVPGDGMI
EVKLANGGVLKGKTVILSTGARWREVNVPGEREYRNHGVAYCPHCDGPLFKGKRVSVIGG
GNSGVEAAIDLAGIVSHVTLLEFAAELKADAVLVRKLKSLPNVTIVTSAQTTEITGDGKK
VNGISYKERASGEVRHVELEGVFVQIGLVPNTEWLKGTVALSKHGEIEIDAKGQTSIPGV
FAAGDVTTVPYKQIVIAVGEGSKAALSAFDHLIRSSAPEEAPVAVKEAVTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaaagcccaattgaaagcctacctggaaaaggtcacgcagcct
atcgagatcgtcgcgtcgctggatgatggcgccaaatcccgtgagttgcaggaactgctg
caggaaatcgtcacgctgtccgagcgcatcacgctcgttgaacgcaacgatcacgccgcg
cgcaagccgtcgttctcattgaatcgccccggtaccgatatcagcgtgcagttcgccggt
attccgatgggccacgaatttacgtcgctggtgctggcgctgctgcaagtcggcggccac
cccatcaagctcgacgacaaggtgatcgaacagatccgcaatctggatggcgattacgcg
tttgaaacctatatctcgctgacctgccagaactgcccggaagtcgtgcaggcgctcaac
gtcatgtcgatcataaatccgcgcattcgtgcggtgacggtggacggcgcgctgttccag
gacgaagtcgagaagcgccagatcatggctgtgccgaccgtctacatgaacggtgaagtg
ttcggccagggccgcaccggcgtggaagaaatcctcgccaagctcgacaccggcgctgcg
gcgcgcaagggtgaagaactgagcgccaaagaagcctatgacgtgctcatcgtcggcggt
ggtcctgccggcgccgcagccgcgatctatgcagcgcgcaagggcatccgcaccggcgtc
gtcgccgagcgtttcggcggccaggtgctcgacaccctggcgattgagaacttcgtctcc
gtcaaggaaaccgaaggtccgcaattcgccacagcgctggaacaacacgtccgtgcctac
gacgtcgacatcatgaacatgcaacgcgccgaagcgctggtgccgggcgatggcatgatc
gaagtcaagctggccaacggcggcgtgctcaagggcaagaccgtgatcctgtcgaccggt
gcgcgctggcgtgaagtcaacgtgccgggcgagcgcgaataccgcaaccacggcgtggcg
tattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtgtcggtcatcggcggc
ggcaactccggcgtggaagcggcaatcgacctggccggcatcgtgagccatgtcacgctg
ctggaattcgcggcggaactgaaggcggatgcagtgctggtgcgcaagctgaaaagcctg
cccaacgtcaccatcgtcacgtcggcgcagactaccgaaatcaccggcgacggcaagaag
gtcaatggcatcagctacaaggaacgcgccagcggtgaagtcaggcacgtcgaactggaa
ggcgtgttcgtccagatcggcctggtgccgaacaccgaatggctcaagggtacggttgct
ctgtccaagcacggcgaaatcgaaatcgacgccaagggccagacttcgattcccggcgtg
ttcgctgccggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgcggtcggtgaa
ggttccaaggcggcattgagcgccttcgatcacctgatccgcagttcggcaccggaggaa
gctccggtcgccgtcaaggaagccgtcacggcgtaa

DBGET integrated database retrieval system