KEGG   Herbaspirillum hiltneri: F506_14110Help
Entry
F506_14110        CDS       T04039                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hht  Herbaspirillum hiltneri
Pathway
hht03030  DNA replication
hht03410  Base excision repair
hht03420  Nucleotide excision repair
hht03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hht00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    F506_14110
   03410 Base excision repair
    F506_14110
   03420 Nucleotide excision repair
    F506_14110
   03430 Mismatch repair
    F506_14110
Enzymes [BR:hht01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     F506_14110
    6.5.1.6  DNA ligase (ATP or NAD+)
     F506_14110
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     F506_14110
DNA replication proteins [BR:hht03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    F506_14110
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     F506_14110
DNA repair and recombination proteins [BR:hht03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     F506_14110
   NER (nucleotide excision repair)
    Other NER factors
     F506_14110
   MMR (mismatch exicision repair)
    Other MMR factors
     F506_14110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AKZ65379
UniProt: A0A0K2BJ69
LinkDB All DBs
Position
complement(3108099..3108905)
Genome map
AA seq 268 aa AA seqDB search
MFLFFAHGVATAERAPVMLANVYRPGIALEDYWVSEKYDGVRGLWDGRRLLTRGGETIHA
PAWFVAGWPAVPLDGELWAGRGGFQQAVSTVRQQTPDDKAWSKMRFMVFDMPGQAGDFTS
RLRTTRSTVQQMNLPWVQAVEQRKVADHAALQALLDRTVAQGGEGLMLHRGSSLYRAERN
DDLLKFKPYEDTEARVVGHLPGKGKYAGMLGALEVETPGGVRFKLGSGLTDAQRRDPPAI
GALVTYRYRGFNDSGIPRFAVFMRVREE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ctgtttctctttttcgcgcacggcgtcgctaccgccgaacgcgcgccggtcatgctggcc
aacgtctatcgtccgggtattgcacttgaggattattgggtcagcgaaaaatacgacggc
gtgcgcggcttatgggatggacgtcgcctgctcacgcgtggaggagagacgatccacgcg
ccggcctggtttgtcgccggctggccggctgtgccgctcgatggagaattgtgggcggga
cgcggcggcttccagcaagcggtgtcgacggtgcggcagcagacacccgacgacaaggcc
tggagcaagatgcgtttcatggtattcgacatgcctggccaggccggcgatttcacttcg
cgcctgcgcacgacgcgcagcaccgtgcagcagatgaacttgccttgggtgcaggcggtc
gagcagcgcaaggtcgccgatcatgccgccttgcaggcgctgctcgatcgcaccgttgca
cagggcggagaaggtctgatgctgcatcgcggatcatcgctgtaccgcgccgaacgcaac
gacgacctgctcaagttcaaaccgtatgaagacacggaagcgagagtggtcgggcatctg
cccggaaaagggaaatacgccggcatgctcggcgccttggaagtggaaacgccgggcggg
gtacgcttcaagctgggcagcggcctcaccgacgcccagcgtcgcgatccgccggcaatc
ggtgcactggtaacctaccgctatcgcggattcaacgatagcggcatcccgcgctttgcg
gtgttcatgcgtgtcagggaagagtga

DBGET integrated database retrieval system