KEGG   Halomonas huangheensis: AR456_01925Help
Entry
AR456_01925       CDS       T04119                                 

Definition
(GenBank) beta-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
hhu  Halomonas huangheensis
Pathway
hhu00061  Fatty acid biosynthesis
hhu01100  Metabolic pathways
hhu01212  Fatty acid metabolism
Module
hhu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hhu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AR456_01925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hhu01004]
    AR456_01925
Enzymes [BR:hhu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AR456_01925
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     AR456_01925
Lipid biosynthesis proteins [BR:hhu01004]
 Fatty acid synthase
  Component type
   AR456_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ALM54472
LinkDB All DBs
Position
complement(405526..406041)
Genome map
AA seq 171 aa AA seqDB search
MTKQHSFDRDQLLACSRGELFGPGNAQLPAPNMLMLDRIAGIYEEGGEYGKGELIAELDI
RPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFYLGWLGHPGRGRALGCGEVKFSGQIMPE
AQKVTYRINIKRVITRRLILGMADGTVSVDGRDIYQANDLRVGLFTSTANF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagcaacactctttcgatcgtgatcaattgctggcatgcagccgcggtgagctg
ttcggcccgggcaatgcccaactgccggcccccaacatgctgatgctggatcgtattgca
ggcatctacgaagagggcggcgaatatgggaagggcgagctgatcgccgagctcgatatc
cgccctgatctgtggttcttcgactgccacttcccgggcgaccccgtgatgcctggctgc
ctcggccttgatgccatgtggcagttggttggcttctatctcggttggctcggccatcca
ggacgtggccgcgctctcggctgtggagaggtcaagttcagtggccagatcatgcccgaa
gcccagaaggtcacgtaccgtatcaatatcaagcgcgtcatcactcgccgcctgattcta
ggcatggcggacgggactgtttccgtcgatggccgcgacatctatcaggccaacgatctg
cgcgtcggcctgttcacctccactgcgaacttctga

DBGET integrated database retrieval system