KEGG   Halomonas huangheensis: AR456_05670Help
Entry
AR456_05670       CDS       T04119                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
hhu  Halomonas huangheensis
Pathway
hhu00071  Fatty acid degradation
hhu00280  Valine, leucine and isoleucine degradation
hhu00281  Geraniol degradation
hhu00310  Lysine degradation
hhu00362  Benzoate degradation
hhu00380  Tryptophan metabolism
hhu00410  beta-Alanine metabolism
hhu00640  Propanoate metabolism
hhu00650  Butanoate metabolism
hhu00903  Limonene and pinene degradation
hhu00930  Caprolactam degradation
hhu01100  Metabolic pathways
hhu01110  Biosynthesis of secondary metabolites
hhu01120  Microbial metabolism in diverse environments
hhu01130  Biosynthesis of antibiotics
hhu01200  Carbon metabolism
hhu01212  Fatty acid metabolism
Module
hhu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AR456_05670 (fadB)
   00650 Butanoate metabolism
    AR456_05670 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AR456_05670 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AR456_05670 (fadB)
   00310 Lysine degradation
    AR456_05670 (fadB)
   00380 Tryptophan metabolism
    AR456_05670 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AR456_05670 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AR456_05670 (fadB)
   00281 Geraniol degradation
    AR456_05670 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AR456_05670 (fadB)
   00930 Caprolactam degradation
    AR456_05670 (fadB)
Enzymes [BR:hhu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AR456_05670 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AR456_05670 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AR456_05670 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     AR456_05670 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ALM54548
LinkDB All DBs
Position
1246600..1248753
Genome map
AA seq 717 aa AA seqDB search
MIYQGNAITVARNGDDIAILTFDLKDGSVNKLSAAVVAELGEALEAVRSESGLKGLMLKS
AKEAFIVGADITEFHGMFEAGEAEITAMLERVHGIFNGLEDMPFPTVTAINGLALGGGCE
VVLCTDFRVMSETAKIGLPETRLGILPGWGGCVRLPRLIGADNAIEWIAGGTENRADACL
KVGAVDAVVPGDQLEAAALDILARANAGEFDIEARRREKTSPLKLNAIEQMMAFETAKGY
VAGKAGPHYPAPIESIKVIQKGAGEGRERAQAIESKSFAKLTQTEVCYNLVGLFLNDQVV
KKAGSQYAGQAQPVKQTAVLGAGIMGGGIAYQSASKGTPILMKDIKEEAIELGLKEARKL
FGKQLERGKLTSDGMAQKLSNIRPTLSYGDFGNVDLVVEAVVENPKVKDAVLTEVESQVS
DTTILASNTSTISINRLAENLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDAAVAATVA
YARAMGKTPIVVNDCPGFLVNRVLFPYFGGFSMLVEQGADFQRVDKVMEKFGWPMGPAYL
LDVVGMDTAVHANEVMAEGFPDRMAREEKTAIQVMFENDRLGQKNAKGFYGYEEDRKGKP
KKVVDEQALELVKSVTTASREFSDEDIIARMMVPLCMETVRCLEDGIVGSPAEADMALIY
GIGFPPFRGGALRYIDAMGLAEFVAVAEGLADELGPLYAPTEKLRQMANNGDTFYAK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaggcaatgccattacggtggcgcgcaatggcgatgatatcgccatactg
acctttgacctcaaggacgggtcagtgaacaagctatctgcggcggtggtcgcggagttg
ggcgaagcgcttgaggcagtgcgttctgaaagtggtctcaagggtttgatgctcaagagc
gccaaggaagccttcattgtcggtgccgatatcaccgagtttcatggcatgttcgaagcg
ggagaggcagagatcaccgccatgctcgaacgtgtacacgggatattcaatggtctcgag
gacatgccgttcccgaccgtcactgcaatcaatggtctggcactgggcggtggttgcgaa
gttgtgctgtgtaccgacttccgagtgatgagcgaaaccgcgaagattggtttgcctgaa
accaggctgggcatcctgccgggttggggtggttgtgtacgcctgccgcgcttgatcggt
gcggataacgccatcgaatggattgccggtggtacggaaaaccgtgccgatgcctgtctc
aaggttggtgctgtggatgccgtggtgccgggcgatcaactggaagctgcggcactggat
attctggcgcgtgccaacgcaggcgagtttgatattgaagcacggcgtcgcgagaagacc
agccccctgaagctcaacgctatcgagcagatgatggctttcgagaccgccaagggctat
gtcgccggcaaggcggggccgcactacccagcaccgattgagtcgatcaaggttatccag
aagggcgccggtgaaggtcgcgagcgcgcccaggccatagagtcgaagagtttcgccaag
ctgacgcagactgaggtctgctacaacctggtcggcctgttcctcaacgaccaggtggtc
aagaaggcggggtcgcagtacgccgggcaggctcagccagtgaagcagactgcggtgctt
ggcgctggcatcatggggggcggtattgcctaccagagcgcgtccaagggtacgccaatc
ctgatgaaggacatcaaggaagaggcgatcgagttgggcctcaaggaagctcgcaagctg
ttcggcaagcagctcgagcgtggcaagctgacttccgatggtatggcgcagaagctctcc
aatattcgtccgacactatcttatggcgacttcggtaatgttgacctggtcgtcgaggcg
gtcgttgagaatccgaaggtcaaggatgccgtgctgaccgaggtcgaatctcaggtctcg
gacaccaccatcctcgcttccaacacctcgaccatctcgatcaatcggctggccgagaac
ctcaagcgccctgagaatttctgcggcatgcacttcttcaatccggtgcaccgcatgccg
ctggttgaagtcatccgcggagaaaagaccagtgatgccgctgtggcggcgacggtggcc
tatgcccgcgccatgggcaagacaccgatcgtagtcaacgattgtccgggcttcctcgtc
aaccgtgtgttgttcccgtatttcggtggcttcagcatgctggtagagcagggtgctgat
tttcagcgtgtcgacaaggtcatggagaagtttggttggccgatggggccggcatatcta
ctcgatgtcgtcggtatggatacggccgtgcatgccaatgaggtcatggcagaaggcttc
cctgatcgcatggcgcgtgaagagaaaaccgctatccaggtaatgttcgagaatgatcgt
cttggccagaagaacgccaaaggcttctatggctatgaagaagatcgcaagggcaagccg
aagaaggtggtcgatgagcaggcgttggagctggtcaagtcggtgaccactgccagtcgt
gagttcagcgatgaggacattatcgcgcggatgatggtaccgctgtgcatggaaaccgtg
cgctgtctggaggatggtatcgtcggcagcccggccgaggcagatatggcattgatctat
ggcattggtttcccgccgttccgcggtggtgcgctgcgttacatcgatgctatgggcctg
gcggagttcgttgccgtcgcagagggtctggccgatgagctcggcccgctgtatgcgccg
accgaaaaactgcgccagatggccaacaatggcgacaccttctacgccaagtga

DBGET integrated database retrieval system