KEGG   Halomonas huangheensis: AR456_07500Help
Entry
AR456_07500       CDS       T04119                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hhu  Halomonas huangheensis
Pathway
hhu00473  D-Alanine metabolism
hhu00550  Peptidoglycan biosynthesis
hhu01100  Metabolic pathways
hhu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hhu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AR456_07500
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AR456_07500
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AR456_07500
Enzymes [BR:hhu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AR456_07500
Peptidoglycan biosynthesis and degradation proteins [BR:hhu01011]
 Precursor biosynthesis
  Amino acid ligase
   AR456_07500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 RimK ATPgrasp_ST ATPgrasp_Ter ATP-grasp_4 ATPgrasp_YheCD ATP-grasp_5 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: ALM52145
UniProt: W1N6C1
LinkDB All DBs
Position
1663148..1664074
Genome map
AA seq 308 aa AA seqDB search
MSAQDNNFGRVVVVFGGDSAERDVSLNSGAAVLSGLQRSGVDAIGYDLAEAGVAGLEALK
PDMVFIAVHGRGGEDGCLQGALELAGIPYTGSGVMASALGMDKLRTKALWQSAGLPTPES
ILMTSETSHAELIERLGLPLIIKPVHEGSTIGITIVRHAEELEKAWQDAAGFDARVMAER
FVAGGEFTLSVLGDRALPAIRVEVPSGFYDYEAKYLSNDTLYHIPCGLEPEEEAELAELC
LSAFDAVGCCGWGRVDVMRDAEGRFWLLEVNTVPGMTDHSLVPQAAAHAGIDFDQLVVRI
LATALERR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcgcaagacaataatttcggtcgagttgtggtggtgttcggcggcgatagtgcg
gagcgtgatgtgtcgctcaatagcggcgcagcagtgctgtctggtctacagcgtagtggc
gtcgatgctatcggctatgacctcgcggaagcaggcgtcgccgggctcgaggcactcaag
ccggatatggtattcatcgcagtgcatggcaggggaggtgaggacggttgtctgcagggt
gccctggagctggccggcattccctataccggtagcggtgtgatggcatcggcgttgggc
atggacaagctgcgcaccaaggcgctgtggcaatcggcgggtttgccaacgccggaaagc
atcctgatgaccagcgaaaccagtcacgccgagttgattgagcgactgggactgccgctg
atcatcaagccggttcatgaagggtcgactatcggtatcaccatcgtgcgccacgctgag
gagttggaaaaggcctggcaggatgccgcaggatttgacgcacgagtcatggctgagcgt
tttgttgctggaggcgaatttaccttgtcggttcttggagacagggcgttaccggctatt
cgtgtcgaggttcccagtggattctatgactatgaagccaagtatctttccaatgacacg
ctctaccacattccctgtggactcgagcctgaggaggaggctgagctggccgaactctgt
ctctcggccttcgacgccgtgggctgttgcgggtggggccgtgtcgatgtaatgcgcgat
gccgaagggcgtttctggttgctcgaagtcaacacggttccggggatgacggaccacagc
ctcgtacctcaagcggctgcgcacgctggcatcgattttgatcaactggttgtgcggatt
ctcgccactgccctggagcgtcgctga

DBGET integrated database retrieval system