KEGG   Halomonas huangheensis: AR456_10095Help
Entry
AR456_10095       CDS       T04119                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
hhu  Halomonas huangheensis
Pathway
hhu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hhu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AR456_10095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hhu02000]
    AR456_10095
Transporters [BR:hhu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    AR456_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_16 AAA_7 AAA_21 AAA_29 Mg_chelatase AAA_22 AAA_25 AAA_18 DUF87 AAA_33 AAA Sigma54_activat NACHT
Motif
Other DBs
NCBI-ProteinID: ALM52590
UniProt: W1ND22
LinkDB All DBs
Position
2280116..2281534
Genome map
AA seq 472 aa AA seqDB search
MKTIMEVRDLSVTTSDNTTLVWPISFTLQPGIPLTLLGETGSGKSLLAQALMGNLPSGLK
ASGVVMIDGEDLMSMPENQRRSWWGRRMTMLPQEPWHALDPIMRVGAQIQEGHQLVAGLE
ASAARNAMLDDLATLGLNDSEFKLPMQLSGGMAQRAAFAAARAGNAPIVIADEPTKGLDS
ARRDDVVRLLREALGSAGGLLTITHDMAVAEQLGGMVMIMRRGECLESGKSETVLAAPQS
AYGQQLMAANPERWPARQLPPSASADVVLDAREVSLQRGGKALFKDLSLALHRGEILGVN
GASGSGKSSLGDLLLGLIPPDSGQVLRAEGIAATRFLKLYQDPPAAFSPWWRLGTLLKDL
CKLHKLSWAIIPPLMERLSLAPELLERRPDSISGGELQRFSILRALMLEPVFLFADEPTS
RLDPITQQQTLELLIELARERDCALLLVSHDRALVDHACDRQISLQTSAICV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatcatggaagttcgtgatctcagtgtcaccaccagcgacaacaccacactg
gtatggccgatctcctttactctccagcccggtattccgctgacattgctcggcgagacg
gggtccggcaagagcctgttggcccaggcgctgatgggaaatctgccatcgggactcaag
gctagcggcgtcgtcatgatcgatggtgaagacttgatgagcatgccggagaatcagcgt
cgcagctggtggggacggcgtatgaccatgctacctcaggaaccctggcatgcccttgac
ccgatcatgcgcgtcggcgcgcagattcaggagggccatcaactggtggcgggactggag
gcttccgctgcgcggaatgccatgctcgacgatctggcgacgctggggctgaacgatagt
gaattcaaactgccgatgcagttgtccggcggtatggcccagcgagcagctttcgcggcg
gcacgtgctggtaatgctcccattgttatcgccgatgagcccaccaaggggctggacagt
gcgcgtcgtgatgatgtcgtgcgactgcttcgcgaagcgctggggtcggccggtggccta
ttgaccatcactcacgacatggcggtggccgagcaattgggcggcatggtcatgatcatg
cgccgtggagagtgtctcgaaagcggcaagtccgagacagtgctggcagcgccacaaagt
gcttacggtcaacagttgatggccgccaacccggaacgctggccagcacggcagctgccg
ccgtccgcttcagcggatgtggtgctcgacgccagagaagtgtcactgcagcgtggtggc
aaagcgctgttcaaggacctttctcttgcattgcatcgtggcgagatccttggcgtcaat
ggtgccagcggcagtggcaagagcagtcttggtgatctgctgctgggcttgattccgccc
gacagtggacaggtcctgcgcgcggaaggcattgccgcgacgcgcttcctgaagctctac
caggacccgcccgcagccttctctccctggtggcgattgggcaccttgctcaaggatcta
tgcaaactgcacaaactgagctgggctatcatcccgccactgatggagcgtctgagtctg
gcaccggagctgctggagcgacgcccggacagcatctccggaggcgagctgcagcgcttc
tcgattctaagagcactgatgctcgaaccggtgtttctgtttgccgacgagccgacctcg
cgactggaccccatcactcagcaacagacgctggaattgttgatcgaactggctcgagag
cgtgactgcgcgctgctgctcgtcagccatgatcgcgctctggtcgatcatgcctgtgac
cggcagatttctctgcagacctcagctatctgcgtgtaa

DBGET integrated database retrieval system