KEGG   Halomonas huangheensis: AR456_19970Help
Entry
AR456_19970       CDS       T04119                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hhu  Halomonas huangheensis
Brite
KEGG Orthology (KO) [BR:hhu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AR456_19970
Enzymes [BR:hhu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AR456_19970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_oxidored K_oxygenase FAD_binding_3 Glutaredoxin AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALM54291
UniProt: W1N5S6
LinkDB All DBs
Position
4589990..4591546
Genome map
AA seq 518 aa AA seqDB search
MLDDSLKTQLKAYLEKVTQPFELVATLDDGDKSRELHGLLSDIAALSDNITLSTTGTDQR
APSFALHRDGVATGIVFAGIPLGHEFTSLVLALLQVGGHPPKASAEVIEQIKALDADMHF
ETYYSLSCQNCPDVVQALNLMALLNPRISHDAIDGALFQDEVEAREVMSVPSVYLNGQPF
DQGRMSLEQILAKVDTGAEQREAEKISAKDAFDVLTIGGGPAGAATSIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRAVELVPATTPGG
EHEVRFASGASLKSKTLVLATGARWREMNVPGEAEYRNKGVAYCPHCDGPLFKGKHVAVI
GGGNSGVEAAIDLAGIVAHVTLFEFMDELRADAVLQKKLASLPNVDIIKGARTTEINGDG
NRVNGLSYEERASGEIKQLALEGVFVQIGLVPNTEWLKESPVELSPRGEIITDAHGMTSV
PGIFAAGDVTTVPYKQIVIAVGSGATAALGAFDYLIRQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgactcactcaagacacagctgaaagcctatctggaaaaggtcacgcaaccg
tttgagctggtcgccactctcgatgacggcgacaagtccagagaactgcatggcctgttg
agcgatatcgcagcgctttcggacaacatcactctgtccaccacaggcaccgatcagcgc
gcgccttcctttgcgctgcatcgggacggcgttgcgaccggtatcgtgttcgccggtatt
ccgctcggccatgagttcacctctctggtgctcgcactgctgcaggttggcggtcatccg
cccaaggccagtgccgaggttatcgagcagatcaaggcgctcgatgccgacatgcacttc
gagacctattactcgctgtcctgccagaactgcccggacgtggtccaggcgcttaacctg
atggcgcttctcaacccgcgcatctctcacgatgccatcgacggcgcgctgttccaggac
gaagtcgaagcccgcgaagtgatgtcggtgcccagtgtctatctcaatggccagccattt
gatcagggccgcatgagccttgaacagattctcgccaaggtggataccggtgccgagcag
cgtgaggccgagaagatttcggcgaaggacgccttcgatgtattgaccatcggcggtggc
ccagcaggtgcagcgacatccatctatgccgcacgcaagggtatccgtaccggtgtcgca
gccgagcgcttcggcggccaggtactcgataccatggcaatcgagaacttcatctcggtg
caggaaaccgaaggcccgaaactggccactgcgctggaagagcatgtcaaacagtacgat
gttgacatcatgaacctgcagcgcgccgtcgagctggtgccggccaccactcccggtgga
gagcatgaggtacgcttcgcttccggtgccagcctcaagtcaaagacgctggtattggcc
accggcgcccgctggcgtgagatgaacgtgcccggcgaggccgagtatcgcaacaagggc
gtggcctactgcccgcactgtgatggcccgctgttcaagggtaagcatgtggcagtgatc
ggcggtggtaactccggcgtcgaggccgccatcgacctggccggcatcgtcgctcacgtc
accctgttcgaattcatggacgaactacgtgccgacgcagtactgcagaagaaactcgcc
agcctgcccaatgtcgacatcatcaagggcgcccgtaccaccgagatcaacggtgacggc
aaccgagtcaatggcctgagctatgaagagcgcgccagcggtgagatcaagcagctggca
ctcgaaggtgtgttcgtgcagatcggcctggtgcccaataccgaatggctcaaggagtca
ccggtggagctgtcgccgcgcggcgagatcatcaccgacgctcatggcatgacatccgtc
cccggcatctttgccgccggtgatgtcaccaccgtgccctacaagcagatcgtgatcgcg
gtcggcagcggcgctacggcggcactgggtgctttcgactatctcattcgccagtag

DBGET integrated database retrieval system