KEGG   Hathewaya histolytica: NCTC503_00536Help
Entry
NCTC503_00536     CDS       T05971                                 

Gene name
aroF_1
Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
hhw  Hathewaya histolytica
Pathway
hhw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhw01100  Metabolic pathways
hhw01110  Biosynthesis of secondary metabolites
hhw01130  Biosynthesis of antibiotics
hhw01230  Biosynthesis of amino acids
Module
hhw_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hhw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCTC503_00536 (aroF_1)
Enzymes [BR:hhw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     NCTC503_00536 (aroF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB
Motif
Other DBs
NCBI-ProteinID: VTQ84416
UniProt: A0A4U9R079
LinkDB All DBs
Position
1:560556..561362
Genome map
AA seq 268 aa AA seqDB search
MRYEKYEGHKDTEISIGNSKIGGGNIALIAGPCSVESREQIVSIARDVKKSGAKFLRGGA
FKPRTSPYSFQGLGCDGLSLLLEAKKETGLPIVTEIMSTEYLDLFEEKVDVIQVGARNMQ
NFELLKALGKTRKPILLKRGASATIEEFLMASEYILAGGNENVVLCERGIRTFENFTRNT
LDLSAVVALKSLTHLPVVVDPSHGSGLWWMVEPLAKAAVVVGADGLIIEVHNNPEKALCD
GNQSLKPKKFNALVNDLREFARIQNKNI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgaaaaatatgaaggccataaagatacagagatttccataggtaatagcaaa
attggcggagggaatatagctcttattgcagggccttgttctgttgaaagtagggagcaa
atagtctctattgcaagagatgttaagaaaagtggggcaaaatttttaagaggaggagct
tttaagcctagaacttcaccttacagttttcaagggttaggatgtgatggtctttctctt
ttattggaggctaaaaaagaaacaggtttaccaatagttacggagattatgtctacagag
tatttagatctatttgaagagaaagttgatgtgattcaagttggagctaggaatatgcaa
aacttcgaactgttaaaggcattaggaaagacaagaaagcctatacttttaaaacgaggt
gcatctgccactatagaagaatttttaatggcatctgagtatattttagctggtggaaat
gagaatgtggttctttgtgagagaggaattagaacctttgaaaactttacaaggaacact
ttagatttaagtgcagtggttgcactaaaaagtcttacacatcttccagttgtggtggat
ccaagccatggatcggggttatggtggatggtagaacctttagcaaaggcagctgttgtg
gttggagctgatggattaattatagaggtccacaacaatccagagaaagctttatgtgat
ggaaatcaatctttaaaaccgaagaagtttaatgcgttagtaaatgatttaagggaattt
gcaaggattcaaaataaaaatatttag

DBGET integrated database retrieval system