KEGG   Haliscomenobacter hydrossis: Halhy_0686Help
Entry
Halhy_0686        CDS       T01491                                 

Definition
(GenBank) Glycoside hydrolase 97
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00500  Starch and sucrose metabolism
hhy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Halhy_0686
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Halhy_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C DUF2811
Motif
Other DBs
NCBI-ProteinID: AEE48594
UniProt: F4L2N0
LinkDB All DBs
Position
853536..855650
Genome map
AA seq 704 aa AA seqDB search
MKLRNFVVLMLFSSIGEFAFAQGFVQTQASPSGKIVLHFQLSAQGIPSYRIDFLGKPIIA
PSKLGLFLESGQLNQGFKLIQNSSTTFDESWQPVWGEVASIRNHYNELKVKLENTTGQVE
ITFRVFDDGIGFRYGLLGKAGQTGELSVMEEQSEFAMTGDHTAWWQPGDWDSNEHTYTTS
PISKIDGRVYLKETSISTQFIPDYRACQTPIAMRTTTGVHLAIHEAALVNFPAMQLNVNP
ATRTFTAFLVPGAALWRKAIVPVGFQTPWRVVLISPDAPGLLASKLILNLNEPCKIADVS
WIKPTKYVGIWWEMHLGKSTWDYGGTQTGQSAQGSTGHGRHGATTANTQKYIDFAAEHGF
NGVLVEGWNTGWEDWFGKWKEDVFDFQTPYPDYDLKGLAKYSLERGAPIIVHHETSGSAT
GYEKHIDKAFDLMQSLDLHAIKSGYVGRIIPKGEWHDGQWMINHYNRVLEKAAAKKIMVD
AHEPVRPTGLHRTYPNFLASEATRGNEFNAWSVGNPPEHETILPFTRGLGGPIDYTPGVF
NIKFSEYKPSPNEYQVHTTLAKQLALYVTLYSPLQMAADLPEHYQKHLDAFQFIKDVAVD
WDDTRILAAAIGDFIVTARKAKGSPNWFLGAITDELARAQSVKLSFLPAGKTFVATIYED
APDAHWKNNPTAYRIRKVEVNSTSVLTLKLAAGGGAAVSLLPKE
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttagaaattttgttgtcctgatgttgttcagcagcatcggtgaattcgctttt
gcccagggctttgtacaaacccaggcttcgccatccggcaaaattgtgctgcattttcaa
ctatcagcacaaggaatacccagctaccggatcgactttttaggcaaacccattattgct
ccttccaaactggggctgtttttggaaagtggccagttgaatcagggttttaaactcatt
caaaacagcagcactacatttgacgaaagctggcaacccgtttggggtgaagtggccagc
attcgcaaccactacaatgaactcaaagtaaaactcgaaaatacgactggccaagtcgaa
attaccttccgggtttttgacgatgggatcggttttcgctacggacttttgggcaaggcc
gggcaaaccggcgagcttagtgtgatggaagagcaaagtgaatttgccatgactggcgac
catacagcctggtggcagccgggcgactgggacagtaatgaacacacctacaccacctcc
cctatctctaaaattgacgggcgggtatatttaaaagaaacctccatttctacgcagttc
attcccgattaccgggcttgccagacccctattgccatgcgcacgaccacaggggtacat
ttggccattcatgaggcggcgctggtcaatttcccagccatgcagctcaatgtcaaccct
gctacccgaacgtttaccgcttttttggtgccgggtgcagcgctgtggcgcaaagccatt
gtcccggttggtttccagaccccctggagagttgtgctgattagtccggatgcacccggt
ttattggcctcgaaattgatcctcaacctgaatgaaccttgcaaaattgccgatgtgagc
tggatcaaacccaccaagtacgttggcatctggtgggaaatgcacctgggcaaatccacc
tgggattacggcggaacccaaaccggacaaagtgcccaaggcagtaccggacatgggcgc
cacggcgctaccaccgccaatacccagaaatacattgactttgcggctgaacacggcttc
aacggggtattggtggaaggttggaatacgggctgggaagactggtttggcaaatggaaa
gaagacgtgtttgattttcagacgccctatccggattatgatttaaaaggtttggccaaa
tattccctggaacgcggtgcccccatcatcgtccaccatgaaacctccggctcggctacc
ggttatgaaaaacacatcgacaaagcttttgacctgatgcaatcgctggatttgcacgcc
atcaaatcgggttatgtaggccgcatcatccccaaaggagaatggcacgacgggcaatgg
atgatcaaccactacaatcgggttttggaaaaagcagcggccaaaaaaatcatggtcgac
gcacacgagcccgtgcgcccaactggcctacaccgcacttaccccaactttctggcttcg
gaagccacgcggggcaatgaattcaatgcctggagcgtggggaatccacctgaacacgaa
acaatcttgccctttacccgtggcttgggtggaccgattgattacacaccaggggttttc
aacatcaaattttcggaatacaaacccagtcccaacgagtaccaggtgcatacgaccctg
gccaaacaattggccctttacgtcaccttgtactcccccttacaaatggccgccgacttg
cctgaacactaccaaaaacacctggatgctttccagttcatcaaagatgtggccgtagat
tgggacgatacccgcattctggcagcagccattggggattttattgtcacggcacgcaag
gccaaaggttcccccaattggtttcttggcgcgattactgatgaattggcgcgggcacaa
agcgtgaagttgagctttttacccgctggaaaaacatttgtggccacgatttacgaggat
gcgccggatgcacattggaaaaacaatcccactgcgtatcggattcgaaaagtggaggtg
aatagcacgagcgtgttgacgttgaaactggctgcgggcggtggcgcggcggtaagtcta
ctgccgaaggaataa

DBGET integrated database retrieval system