KEGG   Haliscomenobacter hydrossis: Halhy_2110Help
Entry
Halhy_2110        CDS       T01491                                 

Definition
(GenBank) conserved repeat domain protein
Organism
hhy  Haliscomenobacter hydrossis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF11
Motif
Other DBs
NCBI-ProteinID: AEE49995
UniProt: F4KQK6
LinkDB All DBs
Position
complement(2693094..2709539)
Genome map
AA seq 5481 aa AA seqDB search
MNFNPALLFDGGDDHLEYTAGRFIATNASGSMFGAATNLGDGSYENLADLGIDNPHMGKL
GTQQIMWMNSSGPVQIVQPGNFATDRSHVWGYFWNGGSPNVGSGLRLNGTEFYEPNTEAT
AVGSSGYVDGLWTIGAYDGVETWNGLIGEIILYDRNLAAWEKDKVESYLAIKYGNTLTHN
YYAGDWNGTTGTTLWTLGGGYDNDITGIGRDDCQGLNQKQSKSVNNGLQPVIGNADLLAA
TNTGHTGNFTADQSFLLWGANNGAATFGAPYAFAGMSHRLTRIWKTQENGTVGSVKVALP
TSDFPGNATQIHLLVSNDATFDNSDTKTPMTLETVGGVEYYTATVDLTSTQHFTFGAYLV
TPGCVAANLLTWYKATDGVTGSPSVSAWQDLVNGYNVIQNTPNHQPMLQSAAMNFNPALL
FDGGDDHLEYTAGRFIAANASGSMFGAATNIGDGSYENLADLGIDNPHMGKLGTQQIMWM
NSSGPVQIVQPGNFATDRPHVWGYFWNGGSPNVGSGLRLNGTEFYEPTTEATAVGSSGYV
DGLWTIGAYNGVETWDGLIGEIILYDRNLATWEKDKVETYLAIKYGTTLTHNYYAGDWNG
TTGTTVWTLGGGYDNNVAGIGRDDCQALNQKQSKSAYSGLQPVIGNADQLAATNTAHTGN
FTADQSFLLWGSDNGSASFGTPYAFGGMTHRISRIWKTQETGTVGSVKVAVPKANFGGAA
SINLLRSTDATFDGTDSQIAMTLETVGGVEYYTATVDFNSGDYFSFGSNICGPGGVVSNF
VFWLKADAGTSSTTDGASLSSWIDQSLFGHTASQATGSLQPEFKANTGLFNFNPSVTFNP
NARLQANLSVTAPWTNKDGTVYVIYNQEVDGAWRNLVDFGETIGDSNSPQLGMTPSDKIG
NWMDGGGGQDDSPFSVVSGETRMAGYDWIYNTNGALRYHFDGKVASGAASQKIGPTIGSF
LNIGGDPQLGEYFNGQIAEVVAYQERHTPANRQKVHSYLAIKYGITLDKTDNDGSIVEGN
YVASNGAVVWNSTANNSFHNDVAGIGRDDASCFTQKQSKSVNGDDPLVMGRGGIAASNLA
NSNTFANDLAYVLWGNNNLSATTTTALAANGACGIPGIADGRLNRIWLVQTTGATETTKI
KAESLPFNTGGAIYMLVGTDPTMATWDQAIPVTWNASNGETSYDFPANSTKYITFAGSTA
LPANICTGDKVIRWWDQGWTPGALSKNVTIGDQTFNFTITDAGNVRYFPAAYPRTVWSHL
YIPRYDNQENSAIDFKMAMSKPARELEFVVCDIDGWAWGRDKVNITGKLGGVPITGKYTV
SKLPPAAFNIAPNGSNPQPPFTGSIYWLDCLVWGRVSVTFDRPVDEVTISYAKNNLFDSW
KVFNDLRIGDITVRCSEPEPPIPVVDNVYLQKTAPLSPMFVNDTFDYVLTLKNLDCGNKT
IDLTDNLPSTLKWVANTISTNLDYTSANTYGGTQNLSLTALVVPPGTSKIYISAYGSTPG
TYNNQASFTVTGSGNTYQSDDPGQSGSANPTPVTIVAEPFPTATFTVTKSADAASVPKGT
DVEYTFSFNNTTGSAVTVDFQDYLTDSLTYLAGSLVNSLGGTTNTYANEGILSIMGMNLP
TGTSSIKVKVKTTGVDVSNGDNVVPNFAVVIPSNGSGFMPKTVMSNTVNVTVQASADTDG
DGKADSIDQDDDNDGILDTVEEAACSPSAVTCDSDGDGIINSLDLDSDNDGINDVREAGG
TDADNNGIADGIADAQGRPVPAGLTPADIDADGKANPYDLDSDNDAISDLAESGATGLID
ADNNGVVDGPDADNDGIRDSADGNDALVGDASDPTPANTDGTDNPDYADTDSDNDGLKDI
REVGRGALDANNDGFVDSPSDPDNDGIANNGGLDGLPAAYGGLTAPDRDGDGVADSADLD
DDNDGILDTVETTADIDGDGIPNSLDLDSDNDGINDVREAGGIDADNDGIADGAPDGQGR
PVPAGLNPADTDADGKANPYDLDSDNDAISDLVESGHPGLIDANNNGVVDGPDADADGIQ
DSADGIDTAFGDVSDPAPVNTDGTDNPDYTDVDSDNDGINDIKEIGRGSLDGNNDGRVDS
PTDPEGDGIANNGGLDTQAGGFGGLRAPDNDADGVPNNLDLDDDNDGILDSIETTADVDG
DGIPNNLDLDSDNDGINDVREAGGTDADNNGIADGSPDGQGRPVPAGLNPADTDADGKKN
PYDLDSDNDAISDLVENGTPGLTDIDNNGVVDGPDADGDGIQDSADGTDTTFGDTSDPLP
VNTDATDTPDYIDVDSDNNGTKDIAEAGYGALDGNNDGRVDSPTDVDGDGIADNGGLDAQ
PAAFGGLAAPDNDNDGVLDSDDLDDDNDGILDTTEASACSPSVSGCDTDGDGIPNRLDLD
SDNDGINDVREAGGTDANNNGIADGTPDVQGRPVPVGLNPADTDADGKKNPYDLDSDNDG
VSDLVESGMMGALADADNNGVVDGPDADGDGIRDSADGNDAAFGDAADSQPANLDGTDTP
DYIDLDSDNDGLFDIAEAGNPTLDANNDGQVDSPSDPDGDGIANNGGLDTQPAAFGGLSA
PDVDNDGVPDANDLDDDNDGILDAIESTVDTDGDGIPNFLDLDSDNDGINDVREAGGTDN
NGDGIADGVPDGQGRPVPAGLTPADSDGDTKTNPYDLDSDNDGVSDLVESGQTGLVDADD
NGVVDGPDADSDGIRDSADATDTAFGDASDPLPVNTDGAPDNPDYLDTDSDDDGIFDIVE
AGYYNLDGNADGKVDSPTDTDGDGIANNSGLDTQPATFGGLPLPDVDGDGTPDASDLDDD
NDGILDTVETTADSDGDGIPNRLDLDSDNDGINDVREAGGTDADNDGIADGTPDGQGRPV
PAGLTPADTDGDGKTNPYDLDSDNDGISDLVESGATGIADADNNGVVDGPDTDGDGIRDS
ADGNPTGTGDVSDPLPVNTDGLDTPDYIDADSNNNGVFDIAEGGHADLDGNNDGKVDSPT
DPDGDGIANNGGLDILPGGFGGLPTPDGDGDGVADVDDLDDDNDGILDNIEAAACSPAAQ
SCDTDGDGIVNRLDLDSDNDGINDVREAGGTDSDGNGIADGSPNGQGSPVAGGLTPPDTD
LDSKSNPYDLDSDNDGIADLVESGTPGLIDADNNGVVDGPDTDSDGIRDSADGNDAAFGD
ASDPQPVNTDGLDTPDYIDTDSNNNGTSDITEAGYGPLDTDNDGRVDNTADPDGDGIANQ
GDLDTQPAAFGGLPVPDNDGDGAPDSSDLDDDNDGILDALENAACGTASTGCDTDGDGIP
NRLDLDSDNDGLNDVREAGGTDANNNGIADGTPDGQGRPVPAGLTAADTDGDTKRNPYDL
DSDNDGISDLIEGGQPGLIDADDNGVVDGPDADLDGIRDSADADDAAFGDATDPLPANLD
GTDNPDYIDTDSNNNGIFDIGEIGRGSLDGNGDGRVDSPSDPDGDGIANNGGLDSQPAAF
GGLSSPDLDGDGTPDSNDLDDDNDGILDTVEESACSPSSAACDSDVDGIPNRLDLDSDND
GINDVREAGGTDADNNGIADGTPNGQGAPVPAGLTPPDSDSDSKLNPYDLDSDNDAISDL
VESGLPGLIDADNNGVVDGPDADSDGIRDSADGIDTAFGDASDPLPTNTDGTDSPNYTDL
DSDNDGVKDIAEGGHGPLDTNNDGRVDSPTDADGDGVANNAGLDTAPTGYGGLPAPDVDG
DGTSDVNDLDADNDGILNSVEDAVCSIASASCDTDGDGIPNRLDLDSDNDGINDVREAGG
TDANNNGMADGTPDAQGRPVPAGLTPVDSDTDGKANPYDLDSDNDSVSDLIEGGVPGLAD
ANNDGVVDGPDTDGDGIRDSADGNDALIGDAADPLPVNTDATDSPDYTDPDSDNDGLNDI
LEAGHGSLDGNNDGRVDSPSDPDGDGVANNSGLDTQPAAFGGLPAPDIDGDGTPDVNDLD
DDNDGIADAQDPHPLDTDNDGTPNVTDTDDDGDGILDTVETPGQQLDTDNDGTPNATDTD
DDGDGIPDTIEQGTLVAGVYTLPDVDNDGIPDLADQLDTDGDGTPDMTDTDDDGDGLTDA
QDPKPLDTDNDGTPNDTDTDDDGDGILDAAETLGQQLDTDNDGTPNATDTDDDGDGIPDT
VEQGTLVAGVYTLPDVDNDGIPDLADQLDTDGDGTPDVADTDDDGDGLTDTEDPKPLDTD
NDGINNATDPDDDGDGILDTAETPGQQLDTDNDGTPNATDPDDDGDNIPDTTEQGTLVAG
VYTLPDVDNDGVPDLADPLDTDGDGTPDLTDTDDDGDGLSDAQDPKPLDTDNDGTPNATD
PDDDGDGILDTGETAGQQLDTDNDGTPNATDPDDDGDNIPDTTEQGTLVAGVYTLPDVDN
DGVPDLADPLDTDGDGTPDIADTDDDGDGLSDAQDPKPLDTDNDGTPNATDPDDDGDGIL
DTAETPGQQLDTDNDGTPNATDPDDDGDGIPDTTEQGTLVAGVYTLPDVDSDGIPDLADP
LDTDGDGTPDLTDTDDDGDGLSDAQDPKPLDTDNDGTPNATDPDDDGDGILDTAETPGQQ
LDTDNDGTPNATDPDDDGDNIPDTTEQGTLVAGVYTLPDSDNDGIPDLADSLDTDGDGIP
DVSDTDDDGDGLSDAQDPKPLDTDNDGTPNATDPDDDGDGILDTAETAGQQLDTDNDGTP
NATDTDDDGDGIPDTTEQGTLVAGVYTLPDSDNDGVPDLADPLDTDGDTLPDVVDTDDDA
DGIADAQDPKPLDTDNDGINNATDTDDDGDGIADATEVPAARLDTDNDGTPNATDPDDDN
DSIPDTVEQGPLVAGVYTLPDSDGDGLPDLADPLDTDGDGTPDVTDTDDDGDGLSDDQDP
KPLDTDNDGINNATDPDDDGDGILDTAETAGQQLDTDNDGTPNATDTDDDGDGIPDSTEQ
GSLVAGVYTLPDSDNDGRPDLIDAIDTDGDGIPDLTDTDDDGDGLSDAQDPKPLDTDNDG
INNATDPDDDGDGISDITDSKPLDTDNDGTPNATDTDDDGDGIPDTTEQGTLVAGVYTLP
DVDNDGTPDLSDPLDSDGDGVHNGLDTDADNDGIPNAVENATAQNNGDTDNDGTPDYLDL
DSDADGIKDIVEAGGTDTNNDGKLDNPADTDGDGLANTVDPDNGGTVLPIPDTDNDNLPN
FQDNDSDNDGLTDQEETTGVDDPLTTAVPTGTSNPLDPCDPVSCGLSLAAKVFLGGAYDE
LTGMMHDSLRKKNLIPLNQPYNTLTDYNYNGTESVNATVFATTGANAIVDWVLVELRDKN
NPATVLYKRAALVQRDGDIVDTDGSSPLFFTGAAVNSYYVSVKHRNHLGVMSAASIAMTT
TPAVIDFTSGITTNYKIAGARGSDHAQQSFAGNKRALWAGNMANTEALPDPHSGDRVIYQ
GPAADVEEAYFVVLLDSTNNIGVLPVHIVASVYNRADANMDGKVIYQGDNADTDVAFFTV
SLFPDNANALPIFVVYEQIPK
NT seq 16446 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaaccccgcgctcttgtttgacgggggcgacgatcacctggagtataccgct
ggccgtttcattgctaccaacgcctctggctccatgtttggtgcagccaccaacctcggc
gatggaagttatgaaaacctggccgatctaggcatcgacaacccccacatgggcaagctg
ggcacccagcaaatcatgtggatgaacagctctggacccgttcagattgttcaaccaggt
aactttgccaccgaccgatcacatgtctgggggtacttctggaacggcggcagccccaat
gtgggcagcggcttgcgcctcaacggtaccgaattttatgaaccaaataccgaggccacc
gcagtgggtagtagtggctacgtagatggcctgtggaccattggcgcctacgatggtgta
gaaacatggaacggcctgattggagaaatcatcctctacgaccgcaacctggcggcctgg
gaaaaagacaaagtcgaatcttacctcgcgatcaaatacggcaacacgctgacccacaat
tattacgcaggcgattggaatggtaccacgggtaccaccctctggaccctggggggtggc
tacgacaacgacatcaccggaattggccgtgacgactgtcaggggctgaaccaaaaacaa
tccaagtcagtcaacaacgggcttcagcctgtaatcggcaacgccgacttactggccgct
accaatactggtcatactggtaattttactgccgaccagagcttcttgctttggggtgcc
aacaacggtgccgcaacttttggtgcaccttacgctttcgcaggcatgtctcatcgcctc
acccgcatctggaaaacccaggaaaatggtaccgtagggagtgtgaaagtggcgctgccc
acatccgacttcccaggcaatgccacacaaatacacttgttggtgagcaacgacgccact
ttcgacaacagcgataccaaaacgcccatgacgctggaaacggtaggcggggtggaatac
tacaccgctaccgttgacctgaccagcacccagcattttaccttcggtgcctacctggtt
acgcctggctgtgtggccgccaacttgctgacctggtacaaagcgaccgatggcgtgacg
ggcagcccttcggtatcggcctggcaagatttggtgaacgggtacaatgtaatccagaat
accccgaaccaccagccgatgctccaaagtgcagcgatgaacttcaaccctgcgctcttg
tttgacggaggcgacgaccacttggagtacactgctggccgcttcattgctgcaaacgct
tctggttccatgtttggtgctgctaccaatatcggcgatggaagttatgaaaacctggcc
gatctgggcatcgataacccccatatgggcaagctgggcacccagcaaatcatgtggatg
aacagctcagggcccgttcagattgttcaacccggcaacttcgccaccgaccggccgcat
gtgtgggggtacttctggaacggtggcagccccaatgtgggcagcggtttgcgcctcaac
ggtaccgaattttatgaaccaactactgaggccaccgcagtgggtagtagcggctatgta
gacggcttgtggaccatcggtgcctacaacggggtcgaaacctgggacggcctgatcggg
gagatcatcctttacgatcgcaacctcgctacctgggaaaaagacaaagtcgaaacctac
ctcgcgatcaaatacggcaccacgctaacccataattattatgctggcgattggaacggc
accactggcactaccgtgtggactcttggcggaggctacgacaacaacgtggctggtatt
ggccgcgacgactgccaggctttaaaccaaaaacaatccaaatctgcctacagtggcctc
caacctgtgatcggcaacgccgaccaattggccgctaccaatactgcccatacgggtaat
ttcactgctgaccagagcttcctgctctggggatcggacaatggttccgcttccttcggt
actccttatgccttcggtggtatgactcatcgcatttcccgcatctggaaaacccaggag
acgggcacggtagggagtgtaaaagtagctgtccccaaagccaactttggtggcgcggcc
agcattaacctgctccgcagcacggatgcgactttcgacggaacggacagccaaattgcc
atgacgcttgaaactgttggaggtgtagagtattacaccgccactgttgattttaactca
ggcgactacttctccttcggttccaacatctgtggtcctggtggggtggtgagtaacttc
gtcttctggctcaaagccgatgcaggtaccagctccaccaccgacggcgcatcgctcagt
tcctggatcgaccaatcactttttggtcataccgccagccaggccactggcagcttgcag
cccgaattcaaagccaatactggcttgttcaacttcaacccttccgttacgttcaacccc
aacgcgcgtttgcaggccaacttgagtgtaaccgctccctggaccaacaaagacggaacc
gtctacgtcatctacaatcaagaagtggatggcgcctggcgcaacctcgttgattttggt
gaaaccatcggcgacagcaacagcccgcaattggggatgacccctagtgataaaattggc
aactggatggacggcggcggcggtcaggatgattctccgttcagcgtagtttctggagaa
acccgcatggctggttacgactggatctacaataccaatggtgcattgcgctatcatttt
gatggcaaagtggccagcggtgcggcctcccaaaaaattggcccaaccatcggcagcttc
ctcaacattggtggcgacccgcagttgggtgaatacttcaacggtcaaattgccgaggtt
gtggcttatcaagaacgccatacgcccgccaaccgccagaaagtacattcttacctggcc
atcaaatacggcatcaccttagacaaaaccgacaacgacggcagcatcgtagaaggaaac
tacgtggcctccaacggtgcagtggtgtggaacagtactgccaacaacagcttccacaac
gatgtagcgggtatcggtcgtgacgatgcttcttgctttacccaaaagcagtcgaaatcc
gtcaacggtgatgatcctctggtgatgggccgtggtggaattgctgccagcaacttggcc
aacagcaatacttttgccaacgacttggcttacgttttgtggggcaacaacaacctcagc
gcaaccacgactacggctctggccgccaatggtgcctgtggtatacccggcatcgccgac
ggtcgcctcaaccgcatttggttggtacaaaccactggtgctaccgaaaccactaaaatc
aaagccgaaagcctgcccttcaatacgggtggcgcaatctacatgctcgttggcacggat
ccaaccatggctacctgggatcaggcgattcccgtaacctggaacgcctcgaatggcgaa
acgtcttacgatttcccggccaacagcaccaaatacatcacttttgcaggcagcaccgct
ttgcccgccaacatctgtacgggtgacaaagtcatccgctggtgggatcaaggctggacg
cctggtgccctaagtaaaaacgtcaccatcggcgaccaaaccttcaactttaccatcacc
gatgcagggaatgtgcggtatttccctgcggcatatccacgtaccgtttggtcacatttg
tacatccctcgatacgacaaccaggaaaacagcgcgatcgacttcaaaatggccatgtcc
aaacctgctcgtgagctggagtttgtggtttgcgacatcgatggctgggcatggggccgg
gataaagtgaacatcaccggtaaattgggcggggtgcctatcacgggtaaatacaccgtg
agtaaacttccacccgcagctttcaacatcgcacccaatggcagtaacccccaacctccg
tttacgggcagtatctattggctcgattgtttggtttggggtcgcgttagtgtgaccttc
gaccgtccggtggatgaagtaactatttcttatgcaaaaaacaacctgttcgattcctgg
aaggtcttcaatgacctgcgcattggcgacatcaccgttagatgttcggagccagaaccg
cctataccagttgtagacaacgtctatttgcaaaaaacggcacccctcagccccatgttt
gtcaacgacacttttgattatgtcttgaccctcaaaaacctggactgtggcaacaaaacc
attgacctgaccgacaacctgccgtctaccttaaagtgggtcgccaataccataagtacc
aaccttgactatacttctgccaatacgtatgggggaacccaaaacctgagcttaactgct
ttggttgttccgcctggtaccagcaagatctatattagtgcctacggcagtacaccgggt
acctacaacaaccaggcctcatttaccgtaacgggaagtggaaatacctaccagtcggac
gatcccggacaaagtggctcagccaacccaacgccagtaaccattgtcgccgaaccgttc
cccaccgctaccttcaccgtaaccaaatcggctgatgccgcttcggtaccgaaaggaacg
gatgtggaatacacctttagtttcaacaacaccaccggtagcgcagttacagtcgacttc
caggactacctgaccgacagtttgacctacctcgctggttcactcgtgaatagcctgggc
ggtaccacgaatacttacgccaacgaaggtatcctcagcatcatggggatgaacctcccc
acaggtacttcatccatcaaggtgaaagtaaaaaccaccggggttgatgtttctaatggc
gataatgtggtgccaaactttgcagtcgttatcccatcgaatggctctggctttatgccg
aaaaccgtcatgtccaatacggtcaatgttaccgtgcaggcttctgctgacaccgatggc
gatggcaaagcagatagcatcgaccaggacgacgacaacgacggaatcctcgataccgtg
gaagaagcggcttgtagcccctccgctgtcacttgtgattccgacggagatggcatcatc
aacagtttagacctcgattccgacaacgacggcatcaacgatgtacgggaagccggcggt
accgacgccgacaacaatggcatcgccgatggcattgcggatgcacaaggtcgtccggtt
cctgcgggacttacacctgcggatatcgatgccgatggcaaagccaatccgtatgacctg
gatagcgacaacgacgctatttctgacctcgctgaaagtggcgcaacaggcctgatcgat
gccgacaacaacggtgtagtagatggccccgacgccgacaacgatggcatccgcgatagc
gccgacggcaacgatgccctggtaggcgatgcttccgatccaacccccgcgaataccgac
ggcaccgataacccggattatgccgatacagacagcgacaacgatggcctgaaagacatc
cgtgaagtaggccgtggtgccctcgatgccaacaacgatggttttgtagacagccccagc
gatccagacaatgacggtattgccaacaacggcggcctagatggtttacccgctgcttac
ggtggccttactgcccctgaccgcgatggtgacggcgttgccgactccgcagacttggat
gacgacaacgatggaattctcgacacggtcgaaaccacagcagacatcgacggcgacggc
attcccaatagtctcgatctcgacagcgacaacgacggcatcaacgacgtgcgtgaagcg
ggaggaatcgatgccgacaatgatggcatcgccgatggagcacccgatggccaaggccgt
ccggtacccgctggcctcaaccctgctgatacggatgccgatggcaaagccaatccttac
gacctggatagcgacaacgatgccatttctgacctcgttgaaagtggccatcctggcctc
atcgacgccaacaacaatggcgtggtagatggcccagatgccgatgccgatggcattcaa
gacagtgccgatggcatcgataccgcttttggcgacgtttccgatcctgctcctgtcaac
acggatggcaccgataacccagactacacggacgtcgacagtgacaacgatggcatcaac
gacatcaaagaaatcggacgcggttctctcgatggcaataacgacggacgcgtagatagc
cccaccgaccctgaaggcgacggcatcgccaacaacggcggcttggatacccaggcaggc
ggttttgggggcttgcgggcacccgataacgacgccgacggcgttcccaacaaccttgac
ctggacgacgacaacgatggcatcctcgattcgatcgaaacaacagccgatgtagatggt
gatggcattcccaataacctcgacctcgacagcgacaacgacggcatcaacgatgtgcgt
gaagcagggggcaccgatgctgacaacaatggcatcgccgatggctctcccgacggtcag
ggccgcccggttcccgccggacttaaccctgctgataccgatgcggatggcaaaaagaac
ccttacgacttggatagcgacaacgacgccatttctgacctcgttgaaaatggtactccc
gggcttaccgatatcgacaacaatggtgtagtagacggccccgacgccgatggcgatggc
atccaggacagtgcagatggcacggataccacttttggcgacacctccgatccgcttcct
gtgaataccgacgctaccgatacgcccgattacattgacgtcgacagcgataacaatggc
accaaagacatcgctgaagcgggttacggcgccttggatggcaacaatgatggccgggta
gatagcccaactgacgttgatggcgatggtatcgctgacaatgggggcttggatgctcaa
cccgctgctttcggtggcctcgctgcacccgataatgacaacgatggtgtactggactcc
gatgacctggacgatgacaacgatggcatcctcgataccaccgaagccagtgcttgtagt
ccatccgtttcaggttgcgacacggatggcgacggcattcccaaccgccttgatcttgac
agcgacaacgacggcatcaacgacgttcgtgaagcgggcggcaccgacgccaacaacaat
ggcattgccgatggcactcctgatgtgcagggtcgcccggtacctgtcgggctaaatcct
gctgatacggatgccgacggtaaaaagaacccttacgacctcgacagcgacaacgacggt
gtgtctgatctggtggaaagtgggatgatgggcgcccttgccgacgccgacaacaatggc
gtggtagatgggcccgacgcagacggcgacggtattcgcgacagcgccgatggcaacgat
gctgcttttggggatgctgctgattcacaacccgccaatcttgatggcacagataccccc
gattatattgatttggacagtgacaacgatggcctgtttgacatagccgaagctggcaat
cctactttggacgccaacaacgatggtcaagtagacagtccaagcgacccagacggcgat
ggcatcgccaacaatggcggtttggatacccagcctgccgccttcggtggcctgtccgct
ccagatgttgacaacgacggtgtacccgatgccaatgaccttgacgatgacaatgacggt
atcctggatgccattgaaagcaccgttgataccgacggtgatggcatcccgaacttcctc
gatctcgacagcgacaacgacggcattaatgacgtgcgtgaagccggtggaaccgataac
aatggcgatggcatcgctgatggcgtgcccgatgggcaaggtcgccctgtacctgcggga
ctcactcctgccgattccgatggcgacaccaaaaccaatccttacgacctcgatagcgac
aatgatggggtttctgacctcgtcgaaagtggccaaacggggctggtcgatgcagatgac
aatggtgtggtcgatgggcctgatgccgacagcgacggcatccgcgacagcgcggacgct
accgataccgctttcggtgacgcctccgacccactacccgtcaataccgatggggcaccc
gacaatccagattatttggataccgacagcgacgatgacggcatttttgacatcgtagaa
gctggatactacaacctggatggcaacgcagatggcaaagtggacagccccaccgacacc
gatggcgatggaattgccaacaacagcggactggacacccagcctgcaacctttggcggt
ctaccgctgcccgatgtggatggcgatggaacccccgatgccagtgatttggacgatgac
aatgatggcatcctggatacagtagaaaccactgccgattctgatggcgacggtattccc
aaccgccttgatctcgacagcgacaacgacggcatcaacgacgtacgggaagccggagga
accgatgccgacaatgatggcatcgccgatggcacccccgatgggcaaggtcgccctgta
cctgctggccttaccccagcagataccgacggcgacggcaaaaccaatccttacgacctc
gacagcgacaatgatggcatttctgacctcgtggaaagcggagcaacgggtattgctgat
gccgacaacaatggggtagtcgatggccccgataccgacggtgatggcattcgcgacagc
gcggatggcaacccaacgggcactggagatgtaagtgatccactgcccgtcaataccgat
ggtttagatacccccgattacatcgatgcagacagcaacaacaatggagtatttgacatc
gcggaaggtggccacgccgatttggatggcaacaacgacggcaaagtagacagtcctacc
gaccctgatggcgatggtatcgccaacaatggtggcttggatattcttcccggtggtttt
ggtggtctacccacacctgatggcgacggcgacggcgttgccgatgtagatgacctcgat
gacgacaacgacggcatcctggacaacatcgaagcagctgcatgtagccctgctgcccaa
agttgtgataccgatggtgatggcatcgtcaaccgcctcgacctcgacagcgacaacgac
ggcatcaacgacgtgcgggaagctggcggaaccgacagcgatggcaatggtattgctgac
ggatcaccaaatggacaaggtagccccgtggcgggtggcctcaccccaccggacacggat
ctcgacagcaagtctaatccatacgatctggacagtgacaacgacggcattgctgacctc
gtggaaagtggcactcctggattgattgatgccgataacaacggggtagtggatggtcca
gacaccgacagcgatgggatccgcgatagtgcggacggcaacgatgctgcttttggagat
gcctctgaccctcaacccgtcaataccgatggcctcgatacacccgattacatcgatacc
gatagcaacaacaatggcacttctgatattaccgaagcaggttatggcccactagatacg
gacaacgatggccgggtagacaacaccgctgatcctgatggcgatggtattgccaaccag
ggggatttggatacccaacccgctgcctttggtggcctgccagttccagacaacgacggt
gacggcgctccggatagcagcgacctcgacgacgacaacgacggcatcctggatgctctt
gaaaacgccgcttgtggtaccgcttctacaggttgcgataccgatggcgacggcatcccg
aaccgcctcgatctcgattccgacaacgacggactcaacgacgtacgtgaagccggaggt
accgatgccaacaacaacggcatcgccgatgggacacccgacggtcaaggccgccccgtg
cccgctggtttgaccgctgccgataccgacggcgataccaagcgcaatccttatgacttg
gatagcgacaatgatggtatctctgacctcattgagggtggacaaccaggtctcattgac
gccgatgacaatggtgtagtggatggccctgatgccgacttggatgggattcgcgatagt
gccgatgccgatgatgccgcttttggggacgctacggatccacttccggccaacctcgat
ggcaccgacaatcctgattacattgacaccgatagcaacaacaacggcattttcgatatt
ggcgaaattggccgcggtagcctcgacggcaacggtgatggccgcgtagacagcccatcc
gatcctgatggcgatggtattgccaacaatggtggtttggatagccagcctgctgccttt
ggtggtctgtcttctcccgacctggacggcgatgggacgcctgattccaatgacttggat
gacgacaatgacggcattcttgatacggtggaagaaagcgcttgtagcccatcttctgcg
gcctgtgactccgatgtggacggcattcccaaccgcctcgacctcgatagtgacaacgat
ggcatcaacgacgtacgtgaagctggtggtacagacgccgacaacaatggcatcgccgat
ggcaccccgaacggacagggagctccggtgcctgctggcctgaccccacccgattccgat
tctgatagcaaattaaatccgtacgacctcgacagtgacaacgacgccatttcggatctc
gttgaaagtggcttacctggtttaatcgacgcagacaacaacggtgtagtcgatggccca
gatgccgatagcgatggtattcgcgacagcgccgatggaattgatactgcctttggagac
gcttccgatccacttcctacaaataccgatggtacggatagcccgaattatacggatttg
gacagtgacaacgacggggtgaaagacatcgccgaagggggtcacggtccgctcgatacc
aacaacgacggtcgtgtagatagcccaacggatgccgatggtgatggtgtagccaacaat
gctggcctggacacagcgccaacgggttatggtggcttacctgcaccagatgtagatggc
gatggaacttccgacgtcaacgatctggacgccgataatgatggtatcttaaatagtgta
gaagacgcggtttgtagcattgcctccgcatcctgtgatacggatggagatggtattccc
aaccgcctcgacctcgacagcgacaacgacggcatcaacgacgtacgtgaagctggcggc
accgatgccaacaacaacggcatggccgatggtaccccggatgcacaaggtcgtccggtt
cctgctggtctgacgcccgtggattccgataccgatggcaaagccaatccttatgatctg
gacagtgacaatgactccgtttctgatctaatcgaaggaggtgttccaggccttgccgat
gccaacaacgatggtgtagtggatggccccgataccgatggtgatggaatccgcgacagc
gccgatggcaatgatgccctgattggtgatgctgctgatccactgcccgtgaacacggat
gcaacagacagccccgattataccgatccagacagtgacaacgatggattgaatgacatc
cttgaagctggtcatggttccttagacggcaacaacgacggtcgggtagacagcccaagc
gatcctgatggtgatggtgtagccaacaatagtggtcttgacacccaacctgcggctttt
ggtggtttacctgcccccgatattgatggcgacggtacacccgatgtcaacgatttggat
gatgacaatgatgggatagccgatgcacaagatccgcatccattggatacggacaacgat
ggtacacccaatgtaacggataccgacgacgacggtgatggcatcctggatacagtagag
acccctggtcaacaattggataccgacaacgatggaacgcccaatgccacggatacggat
gatgacggcgacggcatccccgataccattgaacagggtacgcttgtagctggtgtatac
accctaccagatgttgacaacgatggcattcccgatttggcggatcaattggacactgac
ggtgatggcacacctgatatgaccgacactgatgacgatggcgatggccttaccgatgcg
caagatccaaaaccactggacaccgacaacgacggtacacccaacgatacggatacggac
gacgacggcgatggcatcctggatgccgcggaaacccttggtcaacaattggataccgac
aacgatggtacccccaacgctacagatacggatgatgacggcgacggcatccccgatacc
gttgaacaaggtacgctagtagctggtgtgtataccctgcctgatgttgacaacgatggt
attcctgacttggcagatcaacttgatacggacggcgacggtacccctgatgtggccgac
acggatgatgacggcgacggccttaccgataccgaagatccaaaaccattggatacggac
aacgacggcatcaataacgccacggatcccgatgacgatggcgatggcatcctggatacg
gctgagacccctggtcaacaattggatacggacaacgatggtacgcccaacgccacggat
cccgatgacgacggtgacaacattcctgataccaccgaacaaggtaccctggtagccggt
gtgtacacactgcctgatgttgacaacgatggcgtgcccgatttggctgatccactcgat
accgacggcgatggcactcctgacctgactgacaccgacgatgacggcgacggcttgagc
gatgcgcaagatccaaaaccactggacaccgacaacgacggtacgcccaacgccacggat
cctgatgatgacggtgatggcatcctagacactggggaaacggctggtcaacaattggat
acggacaacgatggtacacccaacgccacggatcccgatgacgacggcgacaacattcct
gataccaccgaacaaggtaccctggtagccggtgtgtacaccctgcctgatgttgacaac
gatggcgtgcccgatttggctgatccactggataccgacggcgacggcacccctgatata
gctgacacggatgatgatggcgacggcttgagcgatgcgcaagatccaaaaccattggac
accgacaacgatggtacacccaatgccacggatcccgatgacgacggcgacggcatcctg
gatacggctgagacccctggtcaacaattggataccgacaacgacggtacacccaacgct
acggatcccgatgacgatggtgacggcattcccgataccaccgaacaaggtaccttggta
gctggtgtgtacaccctgcctgatgttgacagcgatggtattccagatttggccgatcca
ctcgataccgacggcgatggtacacctgacttaaccgacaccgacgatgacggcgacggc
ttgagcgatgcgcaagatccaaaaccattggacaccgacaacgatggtacacccaacgcc
acggatcccgatgatgacggcgacggcatcctggatacggcagagacccctggtcaacaa
ttggatacggacaacgatggtacgcccaacgcaacggatcccgatgacgacggtgacaac
atccccgataccaccgaacaaggtactttggtagctggtgtgtacaccctacccgacagc
gacaacgacggtattcctgatctggcggattccctcgataccgacggcgatggtataccc
gatgtaagcgacaccgacgatgacggcgacggcttgagcgatgcgcaagatccaaaacca
ttggataccgacaacgacggtacgcccaacgccacagatcctgatgatgacggagacggc
atcctggataccgcggaaacggctggtcaacaattggataccgataatgatggtacgccc
aacgccaccgataccgatgacgatggtgacggtatccctgatactactgagcaaggtacg
ctggtagctggtgtgtacaccctgcccgatagcgacaacgacggagtgcctgatttagct
gatccgctcgacaccgatggcgacacgctcccagatgtcgtggatacggacgacgacgca
gatggcattgctgacgcacaagacccaaaaccgctggacacggacaacgatggcatcaac
aatgccaccgataccgatgacgatggtgacggcattgccgatgcaaccgaagtgcctgcc
gcacgtttggacaccgacaacgatggaacgcccaacgccacggatccggatgacgacaac
gactcgattcccgataccgttgaacaaggaccactggtagctggtgtgtataccctgccc
gatagtgacggcgatggcctacctgatttggccgatccgctcgacaccgacggcgacggt
acacccgatgtaaccgataccgatgacgatggtgacggcctgagcgatgatcaagatccg
aaaccattggatacggacaacgatggcatcaataatgcgaccgaccccgatgacgatggc
gatggcatcctggatacggcggaaacagctggacaacaattggataccgataacgatggc
acacccaacgctaccgataccgacgacgatggtgacggcatccctgacagtaccgagcaa
ggttcgctggtagctggggtatacaccctgcccgatagcgacaatgatggccgccccgat
ttgatcgatgcaattgatactgatggtgacggtattccagacctcaccgataccgatgac
gatggtgacggcctgagcgatgcgcaagatcccaaaccactcgatacggacaatgatggc
atcaacaatgcgaccgatccagatgatgatggtgacggcatttccgacatcaccgattcc
aaaccactggatacggacaacgatggtacacccaacgccaccgataccgatgatgatggt
gacggtatccccgacactaccgaacaaggtacactggtagctggtgtctacaccttgccc
gacgtggacaacgatggtacacctgatttgagtgacccacttgattcagacggcgatgga
gtccacaatggcttagataccgatgccgacaacgatggaattcccaacgcggttgaaaac
gctactgcgcaaaacaacggtgataccgacaacgatggcacccccgactacctcgatctg
gacagcgatgccgacggcatcaaggacatcgtggaagcaggtggtaccgataccaacaac
gatggtaagttagacaacccagcggataccgatggcgacggtttggccaatacagttgat
cccgataacggaggcactgtgctacccatacccgacactgacaacgataacctgccgaac
ttccaggacaacgacagcgataacgatggcttgaccgaccaggaagaaaccactggtgtg
gatgatccattaaccaccgctgtacctacaggaaccagcaacccactcgatccttgtgat
cccgtttcttgtgggctgtctctcgccgctaaggtcttcctgggtggtgcttacgatgag
ttgaccggtatgatgcacgacagcttgcgcaagaagaacttgattccgctgaatcaacct
tacaataccctgaccgactacaattacaatggtacagaatccgtcaacgcaacagtgttt
gcaaccacgggtgccaatgccatcgtagactgggtcttggtggaactgcgtgacaaaaac
aatcctgctacggtgctgtacaaacgtgctgcattggtacaacgggatggggacatcgta
gatacggatggaagctcgccactcttcttcactggcgcggcggtcaacagctactacgtt
tctgttaagcaccgcaaccacctcggggtaatgtctgcagcctcaattgccatgactaca
acgcctgccgtgattgactttacctctggcatcaccaccaactataagattgctggagct
cgaggttcggatcacgcacagcagagttttgcgggcaataaacgtgcactttgggcaggc
aatatggccaataccgaagcactacctgatccacattctggcgaccgggtcatctatcaa
gggcctgctgctgatgtggaagaagcttactttgtcgtactcttggattcaacaaacaac
attggcgttctacccgtacacatcgtagcatcagtgtacaaccgggctgatgccaacatg
gatggtaaagtgatttaccagggcgacaatgccgatacggatgtggcattctttaccgtg
tcacttttcccggataacgcaaatgccctacccatatttgtagtttacgaacagatacct
aaataa

DBGET integrated database retrieval system