KEGG   Haliscomenobacter hydrossis: Halhy_2716Help
Entry
Halhy_2716        CDS       T01491                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00473  D-Alanine metabolism
hhy00550  Peptidoglycan biosynthesis
hhy01100  Metabolic pathways
hhy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hhy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Halhy_2716
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Halhy_2716
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Halhy_2716
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hhy01011]
    Halhy_2716
Enzymes [BR:hhy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Halhy_2716
Peptidoglycan biosynthesis and degradation proteins [BR:hhy01011]
 Precursor biosynthesis
  Amino acid ligase
   Halhy_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEE50584
UniProt: F4L0Y0
LinkDB All DBs
Position
3465603..3466592
Genome map
AA seq 329 aa AA seqDB search
MLKVAILTGGNVAERSVSLKSAETVRKHLNDQKYEKYVIELNGTQFTEQGTGTVVNLNDF
SLPTPNGNIKFDLVYQMLHGHPAEDGCLQGYFEVLGIPYTGCDVMSSAITFNKQACKDFL
RSHNIPMAPSKVLRKGEAINWAELEAMGVPVFVKPNKNGSSYGASKVNTPDQLAGAIEHA
FVYDDEVVVEGFLKGTEFSNGVLRRNGEVVVLPITEIVPHNEFFDFKAKYENQSQEITPA
RLTPEQTAQVQAQTKLIYEAVGCRGICRFDYILVGDTFFFLEANTIPGMSEQSIVPQQAR
AHGWSITELLDAAVDEALERQAMKLSVGN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagtagccatcctcaccggcggaaacgtcgccgagcgcagtgtatccctcaaa
agtgcagaaacggtacgcaaacacctgaacgatcaaaagtacgagaagtacgtgatcgaa
ctcaacggcacgcagtttacggagcaaggtacaggcacggtggtcaacctcaatgatttc
agcttgccaacgccgaatggcaacatcaaattcgatttggtgtaccagatgttgcacggg
catccggctgaagatggttgtttgcagggttactttgaagtgttgggcattccctacaca
ggctgcgatgtgatgtctagcgccattacattcaacaaacaggcctgtaaggatttcttg
cgcagccataacatccccatggcaccatccaaagtgctgcgcaagggcgaggccatcaac
tgggccgagctggaagccatgggcgttcccgtgtttgtcaaacccaacaaaaatggcagt
agttacggtgcctccaaagtcaacacccccgatcaattggcaggtgccattgagcacgct
tttgtctacgacgatgaagtagtggtagaaggtttcctcaaaggaaccgagttttcgaat
ggcgtcctgcgccgcaatggcgaagtagtggtgctgcccatcaccgaaattgtgccccac
aacgagttttttgatttcaaagccaaatacgaaaaccaaagccaggagatcactccggca
cgattgactcccgagcaaaccgcccaggtacaagcccaaaccaaattgatttacgaagcc
gttggctgccggggcatttgtcgctttgactacatcctggtaggggacaccttcttcttc
ctcgaagccaatacgattccgggcatgtccgaacaaagcattgtgccccaacaagcacgt
gcccacggttggagcatcaccgaattgctggatgcagcggtggatgaggctttggaaaga
caggcgatgaagttgagtgtggggaattga

DBGET integrated database retrieval system