KEGG   Haliscomenobacter hydrossis: Halhy_3263Help
Entry
Halhy_3263        CDS       T01491                                 

Definition
(GenBank) Linoleoyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    Halhy_3263
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hhy01004]
    Halhy_3263
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     Halhy_3263
Lipid biosynthesis proteins [BR:hhy01004]
 Desaturase
  Front-end
   Halhy_3263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AEE51122
UniProt: F4KT65
LinkDB All DBs
Position
complement(4112303..4113469)
Genome map
AA seq 388 aa AA seqDB search
MNKPQDVFTFDFRFMSKAQFEKPFSHHICFNSMNKVTFSPSGKFYAILREEVQKYFSEKQ
ISPKGDFRLYLKTIILFSSWIYLYVQLVFFTPESIVLGVFLCLLFGFNWALLGFNVCHDA
CHSSYSNNNAVNSILGYTFNFLGANAFFWKTKHNIVHHTFTNIDGVDADIIQTKLLRLAP
TQHKMGIHRFQHLYCMVLYAVSYLGWVYMNDFEKYFSKEVKGTRINAFDIKEHLVFWLSK
ALYVTIYLVIPIMFVPSIFVFLFGYLIASMACGLVLAMVFQLAHVVEITEFEDATEHDLS
IENEWAIHQLCTTANFAPKNKIVSWICGGLNFQVEHHLFPNISHVHYPKLHLIVQNVCAQ
HGIDYKCYESMGEALGSHFRRMKYLGVA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaataagccccaggatgtatttacttttgattttcgttttatgtctaaagcccagttc
gagaaaccatttagtcatcacatctgtttcaattcaatgaataaagtcacgtttagccct
tcggggaaattttatgccattctacgcgaagaagtccagaaatactttagcgaaaaacaa
atcagtcccaagggagattttcgcctgtatttaaaaacgatcattcttttttcctcctgg
atttacctgtacgtccaattggtattttttacgcctgaatccattgtactgggggtattc
ctgtgtctcttgtttggattcaactgggccttgctgggcttcaacgtttgccacgatgcc
tgccacagcagttattccaacaacaacgcggtcaacagcattttgggttacaccttcaat
ttcctgggggccaatgcctttttttggaagacaaaacacaacattgtccaccataccttc
accaacattgatggtgtagacgccgatatcattcaaaccaaacttttgcgcctggcgcct
acccagcacaagatggggattcatcgctttcagcacctttattgtatggtgttgtacgcg
gtttcttatctgggttgggtgtacatgaatgattttgagaagtacttcagcaaagaagtg
aaaggcacccggatcaatgcgttcgacatcaaagagcacctggtattctggttgtccaaa
gcactgtatgtgaccatttacctggtcattcccatcatgtttgtgcccagtattttcgtc
tttctatttggctacctgattgcctctatggcttgtgggttggtcttggcgatggtgttc
caattggcgcacgtggtggaaatcaccgagtttgaagacgctactgagcacgacctgagc
atcgaaaatgaatgggcgattcaccagttgtgtaccacggccaattttgcaccgaagaat
aaaatcgtgagttggatttgtggcggattgaactttcaggtagagcaccaccttttcccc
aacatcagccacgtgcattacccaaaattgcacctgatcgtgcaaaatgtgtgtgcccaa
cacggaatcgattacaaatgttatgagtcgatgggtgaagccctgggctcgcatttccgg
cgtatgaagtacctgggagtggcgtaa

DBGET integrated database retrieval system