KEGG   Haliscomenobacter hydrossis: Halhy_3696Help
Entry
Halhy_3696        CDS       T01491                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00380  Tryptophan metabolism
hhy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Halhy_3696
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Halhy_3696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AEE51548
UniProt: F4KZX8
LinkDB All DBs
Position
4655456..4656754
Genome map
AA seq 432 aa AA seqDB search
MTFQPTLDFARQMDAQDSLRSFRDQYLFPQHQGRKCLYFCGNSLGLQPKKAGEFIKKELQ
HWQELGVEGHFEGELPWTQYHKSLAPASAHIVGAQADEVIIMNTLTVNLHLMMVSFYRPN
AERFKIIMEAGAFPSDQYAVESQVRWHGYDPAEAIVEVAPRPGEALLHTEDILAAIEQHG
AQTTLVLFAGLNYYTGQVYDMPAITAAGHRVGAYVGFDLAHAAGNVPLHLHDWGVDFAVW
CTYKYINSGPGAPSGAFVHAKHGNKPQTPRFAGWWGHNEERRFLMEKGFDPIPGAAGWQL
SNAPILAYAPMRASHDLFLEAGMPALRAKSEKLTAYLEFLIDSLNIDEPRFDIITPRDPA
QRGAQLSFLTGPTGKQLFDYLTQNGVICDWREHNLPGEKGEKAGVIRIAPTPMYNSFEDV
WRFADLLTKAQL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcaacccaccctcgatttcgcccgtcaaatggacgcccaggactccctgcgt
agtttccgcgatcaatacctgtttcctcagcatcaggggcgcaagtgtttgtatttttgt
ggcaactcactgggactccaacccaaaaaagcgggtgaatttattaaaaaagaactccaa
cactggcaagaactgggggtggaaggccattttgagggggaattgccctggacacaatac
cacaaatccctggcgcctgcatccgcccacattgtcggtgctcaagccgacgaagtcatc
atcatgaataccctcaccgtcaatttacatttgatgatggtgagtttttaccgaccgaat
gctgagcgcttcaaaatcatcatggaggcgggggctttcccttccgaccaatacgccgta
gaaagccaggtgcgctggcacggctacgatcccgctgaagccatcgttgaagtagcccct
cgtccaggagaggcattgctacacaccgaagacatcctcgcggccattgagcaacatggt
gcacaaaccacattggtgctgtttgctggtttgaattattacaccgggcaagtgtacgat
atgcctgcgattactgcggcaggccatcgggtaggggcgtatgtaggttttgatttggcg
catgctgcgggtaatgttcccctgcatttgcacgattggggcgtcgattttgctgtgtgg
tgtacttacaagtacatcaactctggtcccggtgcgcccagtggtgcttttgtacacgcc
aaacacgggaataagccccaaaccccccggtttgctggctggtgggggcacaatgaagaa
cggcgctttttgatggaaaaaggctttgaccccattcccggagcagcgggctggcagttg
agcaacgcgcccattctggcgtatgcgccgatgcgcgcgagtcacgacctgttcttggaa
gcaggtatgccagcgctgcgggccaaaagtgaaaagctcacggcctatcttgaattcttg
attgattccctaaatatcgatgagccccgttttgacatcattaccccccgcgatccggca
caacggggggcgcagctttccttcctgactggccctacaggcaaacaattgtttgattac
ctgacccaaaatggcgtcatctgtgattggcgcgaacacaatttgccgggtgaaaaaggg
gagaaagccggggtgattcggattgctccgaccccgatgtacaattcctttgaagatgta
tggcgttttgcagacttgctgacaaaggcacagttgtag

DBGET integrated database retrieval system