KEGG   Haliscomenobacter hydrossis: Halhy_6270Help
Entry
Halhy_6270        CDS       T01491                                 

Definition
(GenBank) glycosyl hydrolase BNR repeat-containing protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00511  Other glycan degradation
hhy00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Halhy_6270
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Halhy_6270
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Halhy_6270
Bacterial toxins [BR:hhy02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Halhy_6270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Lipase_GDSL_2 BNR_3 BNR Sortilin-Vps10 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AEE54090
UniProt: F4L672
LinkDB All DBs
Position
8002712..8005762
Genome map
AA seq 1016 aa AA seqDB search
MRYFFSTLFCLLVLCGISQTNLPAKEETTVFQSNEEGYKCYRIPAIVKAPKGDLLAFCEA
RRLSCSDHGDVRIVLKRSSDNGLSWSKLEIVAENGNNQAGNPAPVFDLSDKRYPKGRLFL
FYNTGTGSEAEVRNGKAMREVWYKTSIDAGLTWSTPVNITRFVSKPNHPQINPAYNFKED
WRHYANTPGHALQLSAGPYRGRIFVAANHSEGQARDQGKDYLAHGFYSDDHGKSWKLSPN
VNYAGSNENTAAELANGGILMNCRNQSGDAKYRIMATSKSAGAKWDSVYVETQLPDPVCE
GSMINYTSKSGQKWLLFTNLDHQSKRENLVLKVSADEGQTWRTGKVIAAGSAAYSDLVIQ
QDHTIGVLYEKDNYSKIVYAQIREEDLFQSAVITHTDTWKGFERVHFTLNQHLAYYVKPK
QALEGKPWVWRASFPDWHADMDSLLLTQGFYVVFVYVDDQYGSPAAMQAWDQVYNHLVNQ
QNFAPKAALEAVSRGGLYIYAWAKRNPDKVSCIYAEAPVCDIKSWPGGKGKGPGDPKSWA
QFQEVFKLNEAEALAFKDNPIDNLEGLAAFKVPILHVISNQDKIVPSDENTYPLVQRYTA
LGGPATIYPVTDGPQRLEGHHFPINKAADWADFIQNNSYPVKKPLPNRDYMQVHHGLKNI
HRVILTQKKATVAFLGGSITHNKGWRDKTCSYLQERFPHTEFTFIAAGIPSLGSLPHTFR
LQRDVLDRGKVDLLFVEAAVNDRANETDSLTQVRALEGIVRHARRSNPKMDIVVMAFADP
DKTQDYYFERTPVEVHNHELIATHYQLPFINLARAVADKMGNQEFSWAYDFKNLHPSPFG
QELYFSAIKTLLTTAFEDPAVWTESTFYPAPLNRASFDKGKYYAIENAKRDNNWTIDPDW
TPADALPTREGFVHKPMLVANTPGSALSLSFKGTAVGIALVSGADAGMITYSIDRGPSKT
LDLYTQWSGQLHLPWYLMLGADLKPGVHTLNLKISAEKNPKSTGNACRIVYFLLNE
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatttcttttcgactcttttttgtttgctagtgctgtgtggaatcagccaaaca
aacctgccagccaaggaggaaaccaccgttttccaaagcaacgaagaaggatataaatgt
taccgcatccccgccatcgtcaaagcccccaagggagatttgcttgccttttgtgaagcc
cgtcgcctcagttgtagcgaccacggtgacgtacgcattgtgctcaaacgcagcagcgac
aatggcctgagttggagcaagctcgaaattgtggcagaaaatggcaacaaccaggcaggc
aatcctgccccggtttttgatttgagcgataaacgctaccctaaagggcgcttgtttttg
ttttacaacaccggaacgggctcggaagctgaggtcagaaacggcaaggccatgcgggaa
gtttggtacaaaactagtattgatgcaggcttgacctggtcaactcccgtcaacatcacc
cgcttcgtgtccaagcccaatcacccgcaaatcaatcctgcctataattttaaagaagat
tggcggcactacgccaacacaccggggcatgcgttgcaactcagtgccgggccataccga
ggccgcatttttgtggcagcgaaccattcggaaggacaagcccgggatcagggaaaagac
tacctggctcatgggttttattccgatgaccacggcaaaagttggaaattaagccctaac
gtaaactatgctggcagcaatgaaaataccgccgccgaactggcaaacggtggcattttg
atgaattgccgcaaccaatcgggcgatgccaaataccgcatcatggcaacgagtaaaagc
gcgggtgcgaaatgggactcggtatatgtcgaaacccagttgcccgatccggtttgtgaa
ggaagtatgatcaattacacctcgaagagcggacaaaaatggctgctctttaccaatctg
gaccaccagagtaaacgagaaaacctggtactcaaggtcagtgcggacgaaggccagacc
tggcgtaccgggaaagttattgctgcgggtagtgcggcatattccgatttggtcattcag
caagaccatacgattggggttttgtatgaaaaagacaactacagcaaaatcgtttatgct
caaatacgcgaagaggatttgttccaatcggcggtcataactcataccgatacctggaaa
gggtttgaacgggtacatttcaccttgaatcaacatctcgcttactatgtgaaaccgaag
caggcactagaaggcaagccctgggtatggcgggcgtcttttcccgactggcatgccgac
atggacagtttgttgttgacccaaggtttttatgtggtatttgtgtacgtcgatgaccaa
tacggcagccccgccgccatgcaagcctgggatcaagtgtacaatcatttggtaaaccaa
caaaacttcgcccccaaagcagccctggaagctgtgagccgaggtggcttatacatctac
gcctgggccaaaagaaaccctgacaaggtgtcctgcatttacgcagaagcgcccgtatgc
gacatcaaaagttggccgggcggcaaaggcaaagggccgggagaccccaagagttgggcg
cagtttcaggaggtgttcaagttgaatgaagccgaagcactggcgtttaaggacaatccg
atcgacaatctggagggactggcggcttttaaagtccccattttgcacgtgatttcgaat
caggacaaaattgtgccttcggatgaaaatacctatcctttggtgcagcgctacaccgca
cttggtgggccagccaccatttacccggttaccgatggcccccagcgtttggaagggcat
cattttcccatcaacaaagctgcggactgggccgattttatccagaacaacagctatccg
gtcaaaaagcctttgcccaaccgcgattacatgcaagttcaccacgggttaaaaaacatc
catcgggttattttgacgcaaaagaaagccaccgtcgcttttctgggcggctccatcacc
cacaacaaaggctggagggataaaacctgctcctacctccaggagcgattcccgcatacg
gaatttacgtttatcgccgcgggcattccctctttgggtagtttgccccatactttccgt
ttgcaaagggatgttttggaccgtggtaaagttgacctcctttttgtcgaagccgccgtg
aacgaccgcgccaatgagaccgatagcctcacccaggtgcgcgccttggaaggaattgtt
cgtcatgcccgccgtagcaaccccaaaatggacatcgtggtgatggccttcgccgatccg
gataaaacgcaggattattacttcgaaaggacgcccgttgaagtacacaaccatgaattg
atcgccacccattaccaattgcctttcatcaatttagccagagcggtagcggataaaatg
gggaatcaggaattcagctgggcctacgattttaaaaatttgcacccatctccctttggt
caggaactgtatttttcggccatcaaaaccctgttgacgacggcttttgaggaccccgcg
gtttggacagaatctacgttttatccagctccattgaaccgcgccagctttgacaaaggt
aaatattacgccatcgaaaatgccaagcgcgataacaattggacaattgaccccgattgg
acgcctgcggacgctttgcccactcgcgagggttttgtccataagcccatgttggtggcc
aataccccgggcagtgctttgtcgctgagcttcaaaggaactgcggtgggtattgccctg
gtttcgggtgccgatgcgggcatgattacctactccattgacagaggcccatcaaaaacc
ctggatttgtacacgcagtggagcggccaattgcatttgccctggtacttgatgttgggc
gcggatttgaaacccggcgtacatacgttgaacttgaaaatcagtgctgaaaagaacccg
aagagcaccgggaatgcctgccggatcgtgtattttttgctgaatgaataa

DBGET integrated database retrieval system