KEGG   Haemophilus influenzae CGSHiCZ412602: H733_0334Help
Entry
H733_0334         CDS       T03436                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
hia  Haemophilus influenzae CGSHiCZ412602
Pathway
hia00550  Peptidoglycan biosynthesis
hia01100  Metabolic pathways
hia01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hia00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H733_0334
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H733_0334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hia01003]
    H733_0334
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hia01011]
    H733_0334
Enzymes [BR:hia01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     H733_0334
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     H733_0334
Glycosyltransferases [BR:hia01003]
 Polysaccharide
  Bacterial polysaccharide
   H733_0334
Peptidoglycan biosynthesis and degradation proteins [BR:hia01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   H733_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB TarH
Motif
Other DBs
NCBI-ProteinID: AIB45155
LinkDB All DBs
Structure
PDB: 

Position
344791..347385
Genome map
AA seq 864 aa AA seqDB search
MRIAKLILNTLLTLCILGLVAGGMLYFHLKSELPSVEALKTVELQQPMQIYTADGKLIGE
VGEQRRIPVKLADVPQRLIDAFLATEDSRFYDHHGLDPIGIARALFVAVSNGGASQGAST
ITQQLARNFFLTSEKTIIRKAREAVLAVEIENTLNKQEILELYLNKIFLGYRSYGVAAAA
QTYFGKSLNELTLSEMAIIAGLPKAPSTMNPLYSLKRAEERRNVVLSRMLDEKYISKEEY
DAALKEPIVASYHGAKFEFRADYVTEMVRQEMVRRFGEENAYTSGYKVFTTVLSKDQAEA
QKAVRNNLIDYDMRHGYRGGAPLWQKNEAAWDNDRIVGFLRKLPDSEPFIPAAVIGIAKG
GADILLASGEKMTLSTNAMRWTGRSNPVKVGEQIWIRQRANGEWQLGQIPSANSALVSLN
SDNGAIEAVVGGFSYEQSKFNRATQSLVQVGSSIKPFIYAAALEKGLTLSSVLQDSPISI
QKPGQKLWQPKNSPDRYDGPMRLRVGLGQSKNMIAIRAIQTAGIDFTAEFLQRFGFKRDQ
YFASEALALGAASFTPLEMARAYSVFDNGGFLIEPYIIEKIQDNTGKELFVANPKIACIE
CNDIPVIYGETKDKINGFANIPLGESALKPTDESTNGEELDQQPETVPELPELQSNMTAL
KEDAIDLMAAAKNASSKIEYAPRVISGELAFLIRSALNTAIYGEQGLDWKGTSWRIAQSI
KRSDIGGKTGTTNSSKVAWYAGFGANLVTTTYVGFDDNKRVLGRGEAGAKTAMPAWITYM
KTALSDKPERKLTLPPKIVEKSIDTFTGLLSPNGGRKEYFIVGTEPTRTYLSEMQERGYY
VPTELQQRLNNEGNTPATQPQELF
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgcaaaattaatattaaacaccctattaactttatgtattttaggtttagta
gcaggcggaatgttgtatttccacctaaaatctgaattgccctcagtcgaagcattaaaa
accgttgaattacagcaaccaatgcagatttatacggcagacggtaaattaattggcgaa
gtgggcgagcaacgccgtattccagtgaaattagccgatgtgccacaacgcttaattgac
gcatttttagcgacggaagacagccgtttttacgatcatcacggattagaccctatcggc
attgcccgtgcattatttgtcgcagtgagtaatggcggtgcatcacaaggcgcaagtacg
attactcaacaattagcgcgtaactttttcttaacctcagaaaaaaccattattcgtaaa
gctcgtgaagcagtgcttgcggtagaaatcgaaaataccctcaacaaacaagaaatctta
gagctttatttaaacaaaatctttttaggctatcgttcttatggtgttgcagcggcagca
caaacctatttcggtaaatcattgaatgaattgaccttatcggaaatggcgattattgct
ggtttacctaaggcaccttcaacaatgaatccgctttattcgctaaaacgtgcagaagaa
cgccgcaatgtggtgctaagccgtatgttagatgaaaaatacatcagcaaagaagaatat
gatgctgcattgaaagagccgattgtggcgagctatcacggcgcaaaatttgaatttcga
gccgattatgtcactgaaatggtgcgtcaagaaatggtgcgtcgttttggcgaagaaaat
gcttacaccagtggttataaagtatttaccactgtactttcaaaagaccaagctgaagcc
caaaaagctgtgcgtaataacttgattgattacgatatgcgtcacggttatcgcggtggc
gcaccattatggcaaaaaaatgaagccgcttgggacaatgatcgcattgtcggttttcta
cgcaaactacctgattcagagccatttattcctgcggcagtgattggaattgcaaaaggc
ggtgctgatatattgctcgcttctggggaaaaaatgaccttatcaaccaatgcaatgcgt
tggacaggcagaagcaatcctgtgaaagtcggcgagcaaatttggattcgtcagcgtgct
aatggggaatggcaattaggacaaattccctcagcaaattcagcattagtttctcttaat
tcagataatggtgcgattgaagcagtggtcggtggctttagttatgaacaaagtaaattc
aaccgtgcgacacaatctttagttcaagtgggttcttctattaaaccatttatttatgct
gcagcattagaaaaaggcttaacgctttcaagcgtattacaagacagcccgatttctatt
caaaaaccaggacaaaaactgtggcaaccgaaaaactcgcctgatcgttatgatgggccg
atgcgtttacgtgtaggattaggtcaatccaaaaatatgattgctattcgtgcgatccaa
acggcaggtattgatttcactgcagaatttttacaacgttttggctttaaacgtgatcaa
tattttgctagcgaagccttggctcttggtgcagcctctttcacgccattagaaatggct
agagcttattcggtgtttgataatggtggtttcctcattgaaccttatattattgaaaaa
attcaagataacacaggaaaagaattatttgtcgcaaaccctaaaattgcttgtattgaa
tgtaatgatatccctgtgatttatggcgaaactaaagacaaaatcaacggctttgcgaat
attcctttaggcgagagtgccttaaaaccaacagatgaaagcaccaatggcgaagaatta
gatcaacaacctgaaactgtgcctgaattgccagaattacaatcaaatatgaccgcactt
aaagaagatgcgattgatttaatggctgcagcaaaaaatgcttcgtcgaaaatagaatat
gcaccacgagtcattagtggcgaacttgcttttctcattcgtagtgccttaaatacggcg
atttatggcgaacaaggtttagactggaaaggcacaagttggcgtattgcacaaagcatt
aaacgtagcgatataggcggtaaaacaggtaccaccaacagttcaaaagtggcttggtat
gcgggatttggtgcaaacttagtcactacaacttatgttggatttgatgacaacaaacgt
gtacttgggcgtggagaagcgggtgcaaaaacagccatgccagcttggatcacttatatg
aaaacggctttaagtgataagccagaacgtaaattgacactgccgccaaaaattgtggaa
aaaagcattgatacttttacaggtttgctttctccaaacggtggacgcaaagaatacttt
attgtaggtactgaaccgacacgtacctatctttcggaaatgcaagagcgtggttattac
gttcctacagagttacagcaacgcttgaataatgaaggcaatacaccagcgacgcaacca
caagaactcttctaa

DBGET integrated database retrieval system